KEGG   Acropora millepora: 114968865
Entry
114968865         CDS       T06134                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
amil  Acropora millepora
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 TUG-UBL1 Ras_bdg_2 Mst1_SARAH FERM_f0 4HB_MCP_1
Other DBs
NCBI-GeneID: 114968865
NCBI-ProteinID: XP_029204924
LinkDB
Position
Unknown
AA seq 493 aa
MFTKEENTVIDSRGKRLQSWLFLRVLLAFERGVYSLLYYLTLMESNEVFASDGAGFRKQL
SSRSPSEFKTLTSADSRDRSRPFSVSNLPSGASNKPTSPSSHNPVKDFIANFVNRKGGKK
RAGLKRSVTTENVTDESAPVRNIGRGHSFLPCHLRNPTWCDCCGEFIWGLFKQCVRCKNC
KYTCHKRCQENVDLDCTGGWHLGRNNSVDEITMKTLHLIEQDDKRKEPFTLYTEPPTGSL
LRKKIDEFNSSTTGLIMTMRGGNTFQGFIRVQMNLLRPINIIAGESPLSIFDPAQKEEDH
RNPQRTSFFIPSGTSKALHVTSETTVHEVIVALLKKFKVADNPRKFALFECFQEENKHII
LRPMSDMEKPLVLRLLWGGADLRHNFSLQENETGDIVWDVFSLPELQNFMKILDKEEEEH
ILQVKAKYQTYKERLDKALALVEGDKPVREQKSPVRNHISEERSSGDKHLRYQVQETIHK
AVDPAQMRDESDC
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgttcactaaagaagaaaacacagttattgactcaagagggaagcgtctacaaagctgg
ttattcctgcgagtattgctcgcgtttgaacgaggtgtatattcgcttctttactacttg
acattgatggaaagcaacgaggtgtttgccagcgatggagctggatttaggaagcagctc
tcttcaagaagcccttcagagtttaaaactctcacatcagctgatagcagagacaggtct
cggcctttttccgtgtctaatttaccaagcggagcttcaaacaagccaacctcccctagt
tctcacaaccctgtcaaggacttcatcgcaaattttgtgaaccgaaaaggagggaagaaa
cgggctggtttaaaacgctccgtgacgacagaaaatgtgactgatgaatcagctcccgtc
cgaaacattggaagaggacactcattcctcccttgtcatttacgaaatccaacttggtgt
gactgttgtggagagtttatttggggacttttcaaacagtgtgtgcgatgtaaaaactgc
aagtacacatgccataaacgatgccaagaaaatgtagatttggattgcactggtggctgg
catttaggaagaaataactcagttgacgaaatcaccatgaaaacattacatctcatagaa
caggatgacaagaggaaagagcccttcacgctttatactgagcccccaacaggaagcctt
ctgcggaaaaagattgatgaattcaattcctcaacaacaggacttataatgacaatgaga
gggggaaacacattccaaggttttatacgtgttcagatgaatctacttcgtcccattaac
atcattgctggcgagagtccattatcgatatttgatccagcacaaaaggaagaagatcac
cggaatccacagagaacttcatttttcattcctagtggaacatcaaaagctcttcatgtt
acaagtgaaaccacagtccatgaggtgattgtggctctcctgaaaaaattcaaggttgct
gataatcctagaaaatttgctttgtttgagtgttttcaagaagaaaataaacacattatc
cttcgtcccatgtcagacatggagaagcctcttgttttgaggttgctgtggggtggagct
gacctcagacataacttttcactgcaggagaatgaaacgggggatattgtttgggatgtg
ttcagcctgcctgagcttcaaaacttcatgaaaatacttgataaagaggaggaagaacat
attttacaggtgaaggcaaaataccagacctacaaagaaagactagacaaggctttagcc
ttggtagaaggagataaacctgtgagagaacaaaaatcaccagtgagaaatcacatttca
gaggagagatcatcaggcgacaagcatctgagatatcaagttcaagagacaatacataag
gctgttgatccagcacagatgcgtgatgagagtgattgttga

DBGET integrated database retrieval system