KEGG   Acropora millepora: 114969095
Entry
114969095         CDS       T06134                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
amil  Acropora millepora
Brite
KEGG Orthology (KO) [BR:amil00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amil04052]
    114969095
   00536 Glycosaminoglycan binding proteins [BR:amil00536]
    114969095
Cytokines and growth factors [BR:amil04052]
 Growth factors
  Growth factors (RTK binding)
   114969095
Glycosaminoglycan binding proteins [BR:amil00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   114969095
SSDB
Motif
Pfam: FGF Fascin ATP-synt_8
Other DBs
NCBI-GeneID: 114969095
NCBI-ProteinID: XP_029205216
LinkDB
Position
Unknown
AA seq 169 aa
MMYTTIIFLWLTLGLVIFTRTLAFPARSKNSPNTHEVSLHSPNARGFVRIKGSHVDSLAF
TKDDRSAKLQMKSFTVNGSVVVTIQPREKNSYLCVNSDGNLTVETPGNVMSRCLFIEGER
SGYTTFRSHHNRNWYLGFKRNGKVKQPHNTTESQKAARFIIYKTHLTSP
NT seq 510 nt   +upstreamnt  +downstreamnt
atgatgtacacaacgattattttcctctggttaacacttggcttagttattttcacaaga
acattggcatttcccgcgcgaagcaaaaactcgcccaacacgcacgaagtgagtctacac
tcccccaacgcgagaggttttgtaaggataaaaggatcccatgtggatagcctcgccttc
accaaagacgaccgtagtgctaagttgcagatgaaatcattcactgtgaatggttccgtt
gtggtcacaatacaacccagggagaaaaacagttacctgtgtgtcaattcggacggtaac
ctaactgtggagactccaggcaatgttatgagccgttgcctattcatcgaaggagagaga
tctggttatacgacatttcgatcacatcacaacaggaactggtatcttggattcaaacgc
aatgggaaagtcaaacagccacacaacacgactgaatcccaaaaagctgcaagatttatc
atttacaagactcacttaacaagtccgtag

DBGET integrated database retrieval system