KEGG   Acropora millepora: 114975975Help
Entry
114975975         CDS       T06134                                 

Definition
(RefSeq) glutamyl aminopeptidase-like
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
amil  Acropora millepora
Brite
KEGG Orthology (KO) [BR:amil00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amil01002]
    114975975
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amil04147]
    114975975
   04090 CD molecules [BR:amil04090]
    114975975
Enzymes [BR:amil01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     114975975
Peptidases and inhibitors [BR:amil01002]
 Metallo peptidases
  Family M1
   114975975
Exosome [BR:amil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114975975
CD molecules [BR:amil04090]
 Proteins
  114975975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 114975975
NCBI-ProteinID: XP_029212135
LinkDB All DBs
Position
Unknown
AA seq 986 aa AA seqDB search
MESRPLKTHQSGMCDQPAECPRVASPFYATRGRFISRGVIASVVTMIILLIILVAVLGAL
LGKAGPRGTMSLEGQENKDYQDPTPFAGQTTPGTDAWWNVRLPHSISPKHYDVTVRVDLK
KFKFNGHVSILINVTNPTEYVLLHANELLVTLVSAQTIKGNKLSIKKHFWFERNQLHVIH
FDSWLAVGEYVINMSFESVLRSDLSGFYRMQYKRSDGIVSHMAATQFSPADARKAFPCFD
EPAMKATFNVTLIHDSNLIALSNMPIYQSRQEKDGWTYDTFQKSAVMSTYLVAFAICDFK
YVEVAHNNSFKVRIYTPQEQIDQVEYVSKITDRLLTFFEEYFDIEYALPKVDMIAIPNFL
HGAMENWGLITYRDLNLLYKANISSSFHKQRIAEVVSHELAHQWFGNLVTMEWWDDFWLN
EGFASFMEFKSMDFIYPDWKMDDQVVVADMFAAFAEDSMESSHPIRIPIKRPNDISQIFD
SITYDKGACILRMLEFYLGKDVFRRGLSRYLKKFEYANAKTQNLWQVLEEESCMQGRCVN
VNYMMDTWTLQMGYPVIDIRHLTGNQYLVSQQRFLNHKDVNATPKFSSPFNYKWFVPFTY
ISSSGSQTVITKEINMTSEKILCNGSGWIKGNAGQKGFYRVNYDDQNWDALANAFKNDHK
VMNVSDRAGVIGDAFALARSGKINYTKALELTSYLAAEMEYVPWVAAVKSFNLIKELLTP
TRPAYKLLQRYILRQVKPIYERLEFTDRGSHLESLLQPIILDTVCAAGEKLCLLNASNYF
HEWMKDPRRKQVPANFRSLVYYYGIANGGREEWEFSFNQFLSTSVASEKNTLMRGLAASS
EPWILSRYLQLSLDTDVIKSSDTPMVISRVAEASHIGRQLAWDFILRHWKTLKARYSEGL
NVLKRLLEDVTAGFTNEFQLQQVINFVKSYDHGYGKDNLASLSQAVEVIKSNVAWISRNE
KDLETWLTTYLSKVEEKEYINSDLYP
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagacctctgaaaacgcatcagtctggaatgtgtgatcagcctgctgaatgt
cccagggtcgcctcaccattctatgcaacacggggaaggtttatttcaaggggtgtgatt
gcttcagttgttacaatgatcattttactcatcattttagtcgctgttttgggtgctcta
ctgggaaaagcaggacctagaggaacaatgtccttagagggacaggaaaataaagattat
caagatccaacgccatttgctggtcaaaccactccagggacagatgcatggtggaatgta
cgcctgccacactccatttcgcccaaacactatgatgtgacagtccgtgttgatctgaag
aaatttaagttcaatggacacgttagcattctgattaacgtcacaaatcctacggaatat
gtgttgctgcatgccaacgagctactggttacattagtctctgctcaaaccatcaaagga
aataaactttcgataaagaagcacttttggtttgaaagaaaccaattacatgtgatccac
ttcgatagctggctagcagttggggagtatgttatcaacatgtcctttgagtcagttctc
agatcagatctgtccggattctacagaatgcaatacaaacgctctgatgggatagtaagt
cacatggctgcaacgcagttctccccagcagatgcacgtaaggccttcccttgctttgat
gagcctgcgatgaaggcgacgttcaacgtaacgctaattcacgattcgaatttgatagct
ctttccaatatgccaatttaccaaagccgacaggagaaagatggctggacatatgataca
tttcagaaatctgcggtcatgtccacttatctcgtagcctttgcaatttgtgatttcaaa
tacgtcgaagtagctcacaataattctttcaaggtcaggatatatacaccccaggagcaa
attgatcaagtagagtacgtctctaaaatcactgaccgtcttctgacgttcttcgaggaa
tattttgacatagaatacgctttaccaaaagtagatatgatcgctattcctaattttctt
cacggagcaatggaaaactggggactaataacttaccgagacttgaatctgctctataaa
gcaaacatatcgtcatcatttcacaagcaaagaattgctgaggttgtgtcacacgaactg
gctcatcagtggtttggcaacctcgtaaccatggaatggtgggacgacttctggctcaac
gagggcttcgccagctttatggagttcaagtcaatggacttcatttacccagactggaaa
atggatgatcaggtggtggttgctgatatgttcgcagcatttgcagaggacagcatggaa
tcctcccacccaatcagaatacccataaaaagaccgaatgatatcagccaaatatttgat
tctatcacttatgacaagggagcatgcattctacgtatgttggaattctatcttgggaaa
gatgtattcaggagaggcttgtcacgctatctaaagaaatttgagtatgccaatgcaaaa
acacaaaatctgtggcaagtgctggaagaggaaagctgtatgcagggtaggtgtgtgaat
gttaattacatgatggacacgtggacactgcaaatgggttatcctgtcatcgatatcaga
catttaaccggcaaccaatacctagtctcacagcaaaggtttttaaatcataaggatgtc
aacgcgacgccaaagttttcctctccgtttaactataaatggtttgtaccatttacgtac
atctcttcttcgggttctcagacagttattactaaagaaatcaacatgacatcagaaaaa
attttgtgcaacggaagtggctggataaaaggaaacgcaggacaaaagggattttacaga
gttaactacgacgaccaaaactgggatgcacttgccaacgcgttcaagaatgaccataag
gtgatgaatgtttcagatcgtgcaggtgttattggcgatgcatttgcgcttgcaaggagc
ggtaaaataaactacaccaaggcattagaactgacatcatacttagcagctgaaatggaa
tacgttccatgggtggccgcagtaaagagctttaatttaatcaaagaactactaacgcca
acaaggccagcttacaaacttttacagaggtatatccttcgtcaagtgaagcctatctat
gaaaggctggaattcacggatagaggctctcatcttgaaagcttgcttcaacccatcatc
ttagacacagtttgcgcagctggagaaaaattgtgcttgctaaatgcgtcaaattacttc
catgagtggatgaaagatcctcgacgtaaacaagttccagcaaatttccgttcactcgta
tattattatggtatagcaaacggtggccgcgaggagtgggaattctctttcaatcagttt
ttgagtacttctgtagcttcagaaaaaaacaccttgatgcgaggcttagcggcttcatca
gagccgtggattcttagcagatatcttcagttatctctggacacggatgtaattaaatca
tccgacactccaatggtaatcagcagagtggctgaggccagccatattggacggcagttg
gcatgggactttatcttaagacactggaaaacattaaaagcgcggtatagcgaaggactg
aacgtcttgaagcgcctattggaagatgtcacagcgggtttcacaaatgagtttcagctt
caacaggtcataaatttcgtgaagtcgtatgaccatggctatggcaaagacaatctagct
tcactttctcaagctgttgaagtgataaaatcaaatgttgcatggatatcgaggaacgaa
aaagacctggaaacttggctgacaacctatctttcaaaagtggaagaaaaagaatatata
aattcagacctctacccgtaa

DBGET integrated database retrieval system