KEGG   Advenella mimigardefordensis: MIM_c09780Help
Entry
MIM_c09780        CDS       T03016                                 

Gene name
ddl2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00473  D-Alanine metabolism
amim00550  Peptidoglycan biosynthesis
amim01100  Metabolic pathways
amim01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MIM_c09780 (ddl2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MIM_c09780 (ddl2)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MIM_c09780 (ddl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amim01011]
    MIM_c09780 (ddl2)
Enzymes [BR:amim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MIM_c09780 (ddl2)
Peptidoglycan biosynthesis and degradation proteins [BR:amim01011]
 Precursor biosynthesis
  Amino acid ligase
   MIM_c09780 (ddl2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATPgrasp_Ter ATP-grasp_4 ATPgrasp_ST TTL ATP-grasp_5 ATPgrasp_YheCD Chal_sti_synt_C GARS_A
Motif
Other DBs
NCBI-ProteinID: AHG63077
UniProt: W0PC67
LinkDB All DBs
Position
1111875..1112837
Genome map
AA seq 320 aa AA seqDB search
MRNEFGRVGVLYGGQSAERPVSLVSGKGVHEALISKGVDAHLFDTAEHSLAELAAAGFDR
VFIALHGRYGEDGALQGALELLGIPYTGSGVMASGLAMDKIMTKRIWIEQGIPTAPYCQV
RTRDDMDEAARQLGYPFILKAPHEGSTLGLSKVTGPQDLFVAFDDVSRFDSELLAEKFVV
GRELTVAILGKGDTARAFPIIEIVAPDGKYDFEHKYVSDETQYHCPADLPEDLAASIRQT
CEKAFAAVGCEGWGRVDVMLDRDNRYFLLEINTSPGMTPHSLVPMGAKAEGVSYADLCVQ
ILAQASCKIQRTQPVTESAL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatgaatttggcagggttggtgtcctgtatggtggccagtctgcggaacggccg
gtgtcactggtttccggtaagggtgtccatgaggccctgatcagcaaaggcgttgacgct
catctgttcgatacagccgagcattccctggcggaactggctgcggctggttttgatcgt
gttttcattgccctgcacggacgctacggtgaagacggcgcgctgcagggggcgctggag
ttgctgggtattccctataccgggagcggcgtgatggcgtccgggctggccatggataaa
atcatgaccaagcgcatctggatcgaacaggggattccgaccgcgccctattgtcaggta
cgcacccgcgacgatatggatgaggctgcccggcaactgggctacccctttatccttaag
gcgccgcacgaaggctcgaccctgggcctgagcaaagtgaccggtccccaggatctgttc
gtggcctttgacgacgtatcgcggtttgacagtgaactgctggctgaaaaattcgtggtg
ggacgcgaactgactgttgctattctgggtaagggcgacaccgcacgtgcgtttccgatc
atcgaaatcgtcgcgcctgatggcaaatacgatttcgagcacaagtatgtttcggatgag
acgcagtaccattgcccggccgatctgcccgaggatctggccgccagcatccggcaaacc
tgcgaaaaggcatttgctgccgttggttgtgagggttggggccgggtagacgtgatgctg
gatcgcgacaaccgttattttctgctggaaatcaatacatcgcccggcatgacgccgcac
tcgctggtacccatgggcgccaaagccgaaggcgtgagttatgctgatttgtgcgtgcag
atcctggcgcaggccagttgcaagatccagcgcacgcaacccgtgacggagtcggccctg
taa

DBGET integrated database retrieval system