KEGG   Advenella mimigardefordensis: MIM_c09950Help
Entry
MIM_c09950        CDS       T03016                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
amim  Advenella mimigardefordensis
Brite
Enzymes [BR:amim01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MIM_c09950 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHG63093
UniProt: W0PDH8
LinkDB All DBs
Position
1134900..1135433
Genome map
AA seq 177 aa AA seqDB search
MKLEKLLLAGVLAAGLMSAAGAAELKVTMNEATTSGAGKEVGQVTISETPFGLLFTPELK
GLSAGVHGFHVHENASCDAAEKDGKTVPAQAAGGHLDPKKTGKHEGPYSDEGHLGDLPGL
VVAADGTSTYPVLAPRLKALSDVQQHALMIHEGGDNYSDHPKELGGGGGRMVCGVIK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggaaaaattgctactggcaggggtgttggctgcaggattgatgtctgcagca
ggtgccgcagaactgaaagtgaccatgaatgaggcgaccacctcgggcgcgggcaaggaa
gtggggcaggtaacgatcagcgagacgccattcggtctgctttttacacctgagcttaaa
ggccttagcgccggcgtgcatggttttcacgttcacgagaatgccagttgtgatgccgct
gaaaaagacggaaaaacggtaccggcccaggcggctggtggccatttggatccgaagaaa
accggcaagcatgaaggtccctatagcgatgaggggcatttgggagatctgccgggactg
gttgtcgctgcagatggcacatccacctatccggtgctggcgccacgccttaaagccctg
tccgacgtgcagcagcatgcgctcatgattcatgaaggcggtgataattattcagatcat
cccaaggaacttggcggtggcggcgggcgcatggtatgcggcgtgattaaatag

DBGET integrated database retrieval system