KEGG   Advenella mimigardefordensis: MIM_c14370Help
Entry
MIM_c14370        CDS       T03016                                 

Gene name
cbxS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00630  Glyoxylate and dicarboxylate metabolism
amim00710  Carbon fixation in photosynthetic organisms
amim01100  Metabolic pathways
amim01120  Microbial metabolism in diverse environments
amim01200  Carbon metabolism
Module
amim_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amim_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:amim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MIM_c14370 (cbxS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MIM_c14370 (cbxS)
Enzymes [BR:amim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MIM_c14370 (cbxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AHG63528
UniProt: W0PEN8
LinkDB All DBs
Position
complement(1642807..1643226)
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLTNEQITKQLQYCLNNGWAVGIEYTDDPHPRNTYWEMFGNPMFDLRD
AAGILQEIEQARKTFPNHYIRVTAFDSTHTVESVVMSFIVNRPENEPGFRLVRQEIDGRR
MRYTIESYAVAASAEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacaaggcaccttttcgtttcttcctgatctgaccaacgaacagattacc
aagcaactgcagtattgcctgaacaacggctgggctgtcggtatcgaatataccgatgat
cctcatccgcgcaacacctactgggaaatgttcggcaatcccatgttcgatctgcgcgat
gccgcaggcatcctgcaggaaatcgaacaggcgcgcaaaacgttcccgaaccactacatt
cgggtgactgcattcgactcaacacacaccgttgaatctgtcgttatgtcattcatcgtc
aatcgccccgaaaacgagccaggctttcgcctggtccgtcaggaaattgacggacggcgc
atgcgctatacgattgaaagctatgccgtggccgccagcgctgaaggcagccgttattga

DBGET integrated database retrieval system