KEGG   Advenella mimigardefordensis: MIM_c40220Help
Entry
MIM_c40220        CDS       T03016                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:amim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MIM_c40220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amim02000]
    MIM_c40220
Enzymes [BR:amim01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MIM_c40220
Transporters [BR:amim02000]
 Other Transporters
  Pores ion channels [TC:1]
   MIM_c40220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AHG66073
UniProt: W0PM42
LinkDB All DBs
Position
4632304..4632939
Genome map
AA seq 211 aa AA seqDB search
MSASRITFYSNPQSRAAVIHWMLEELGEPYETIYLNYQGAMKTPEYLAVNPMGKVPAIVH
DGQVVTEGAAICAFLADQYPQKNLAPATDSPLRGTYYRWLFFAAGPLEEAITMTSLKMPI
PADKSAMLGFGTLARTVDVLEQAVSGSNWICGEQFTAADVYVGSAIRFYMLFGVLEARPA
FKAYVDRLTQRPAYQRSLKILEQAAATQQKQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagccgcattaccttttactccaacccgcagtcccgcgccgccgtgatccac
tggatgctggaggaactgggcgagccctacgaaacaatctatctgaattatcagggcgcc
atgaaaacccccgagtatctggccgtcaacccgatgggcaaggtcccggccatcgtgcat
gacggtcaggtggtaaccgaaggcgcggccatctgcgctttcctggccgaccagtatccg
caaaaaaatctggcgccggctaccgacagcccgctgcgcggcacctattaccgatggttg
ttctttgccgccggaccgctggaagaagcgatcaccatgacatccctgaagatgcccatt
ccggccgataaaagtgccatgctgggctttggcacactggcgcgcacggtcgatgtactg
gagcaggcggtgtccggcagcaactggatttgcggtgaacagttcactgccgctgatgtg
tacgtgggctcggcgatccggttttatatgctgttcggcgtacttgaagcgcgccctgcg
ttcaaggcctatgttgaccgactcacacaacggcctgcctatcagcgcagcctaaaaata
ctggagcaggcggcggccacgcagcaaaagcaataa

DBGET integrated database retrieval system