KEGG   Aurantimicrobium minutum: AUMI_18400Help
Entry
AUMI_18400        CDS       T05175                                 

Definition
(GenBank) translation initiation factor
  KO
K02519  translation initiation factor IF-2
Organism
amin  Aurantimicrobium minutum
Brite
KEGG Orthology (KO) [BR:amin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:amin03012]
    AUMI_18400
   03029 Mitochondrial biogenesis [BR:amin03029]
    AUMI_18400
Translation factors [BR:amin03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    AUMI_18400
 Prokaryotic type
   AUMI_18400
Mitochondrial biogenesis [BR:amin03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AUMI_18400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU IF-2 IF2_N MMR_HSR1 Ras GTP_EFTU_D2 SRPRB MeaB Arf Roc RsgA_GTPase FeoB_N PduV-EutP
Motif
Other DBs
NCBI-ProteinID: BAU99382
UniProt: A0A173LX00
LinkDB All DBs
Position
sequence1:complement(883763..886474)
Genome map
AA seq 903 aa AA seqDB search
MAAKPRVHEVAAEYGIDSKLALAKLKDLGEFVKGPSSTIEPPVARKLRNALEAEGMKPVP
AGEAAPAAKSAAKAPAKAAPAAEAPAAPAAPTPGPAAPKAEEKPAPAPEAPQAPAADAPA
PKAAGGARPGNNPFASAQGMGTRPAGAPRPGNNPFASAQGMGTRPAGSPSPGSIPRPMAP
RPGGMPRPGGAGGAGRPGGPGRGGAGAGAGFQRPGGGGGFRQGAPGGAPGGAGAPARPGF
GPNRPPAGGGGGRGRGPGGGTAGAFGRGGGKSKARKSKRTKRAEFELREAPSLGGVSVPR
GDGNTVIRLRRGASLADFADKINATPANLVTVLFHLGEMATATESIDEATFEILGEELGF
KIQIVSPEEEDKELLDAFNIDLEQELADESDEDLEIRPPVVTVMGHVDHGKTRLLDAIRK
TNVIAGEAGGITQHIGAYQVHANHDGVDRLITFIDTPGHEAFTAMRARGAQVTDIAILVV
AADDGIMPQTIEALNHAQAANVPIVVAVNKVDKPDANPAKVRQQLTEYNLVAEEYGGDVM
FVDVSALSGLGITELLDAVLLTADAGLDLRANPNKDARGIAIEARLDKGRGAVATVLIES
GTLRVGDAIVAGTAYGRVRAMVDENGTAVEAATPSRPVQVQGLSSVPRAGDTFLVTEDDR
TARQIAEKREAAERNAQLAKARKRISLEDFTKALEDGKVESLNLIIKGDVSGAVEALEES
LLKIEVDESVQLRIIHRGVGAVTESDVNLATVDNAVIIGFNVRPDTKARERALREGVDIR
FYSVIYSALEDIENSLKGMLKPEFEEVQSGVAEIREIFRSSKFGNIAGCIVRSGTITRNS
KARVIREGIVIADGLAIESLRRFKDDATEVKTDFECGIGLGKYNDIQIGDEIETIELKEK
PRV
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
gtggctgccaaaccacgcgtacacgaagttgctgccgaatacggcatcgatagcaagctt
gctctagccaagctgaaagatcttggtgagttcgttaagggaccatcgtcaacaattgag
cctcccgtagcacgcaagctacgtaacgctttagaggcagagggcatgaagccagttcct
gctggcgaagctgcacccgctgcgaagagcgcagcaaaggcgcctgccaaggcagcgcct
gctgctgaagctccagcggcacctgctgcccccacacctggtccggctgcacctaaggcg
gaagaaaagcccgctcccgcaccagaagctcctcaagctccagctgctgatgcaccagca
cctaaggctgccggtggcgcacgccccggaaacaacccctttgcttctgcacaaggcatg
ggaacacgccctgccggtgcaccacgaccaggtaacaaccccttcgcttccgcacaaggt
atgggaacccgccccgcaggttcaccttcccccggaagtattcctcgcccgatggctcct
cgcccaggtggcatgccacgtcccggtggagccggtggcgcaggtcgtcccggtggtcca
ggtcgcggtggcgcaggtgcaggtgctggattccagcgcccaggtggtggtggcggattc
cgtcagggtgctcctggtggagccccaggtggtgctggtgcaccagctcgtccaggtttt
ggccctaaccgtccaccagcaggtggcggtggcggtcgtggccgtggccccggcggtgga
accgctggtgcgttcggtcgtggcggcggaaagtccaaagcacgtaagtcgaagagaaca
aaaagagcagagtttgaactccgcgaggcaccatcgcttggtggcgtaagtgttcctcgt
ggtgatggcaacactgttattcgtttgcgccgcggtgcctcacttgctgactttgccgac
aagatcaatgcaaccccagcaaacttggtaactgttctgttccaccttggtgagatggca
acagcaactgaatcaatcgacgaagcgaccttcgaaattctcggtgaagaactgggcttc
aaaatccagattgtttcccctgaggaagaagacaaagaactgctcgacgcattcaacatc
gaccttgagcaagaacttgctgacgagagcgatgaagatctcgaaattcgtccacccgtt
gttactgtgatgggtcacgttgaccacggtaagactcgtttgctcgatgccatccgtaag
accaacgtcatcgcgggcgaagccggtggaattactcagcacattggtgcctaccaggtt
cacgcaaaccacgatggtgttgaccgtctaatcaccttcattgacacccctggtcacgaa
gcgtttaccgctatgcgtgcccgtggtgcgcaggtaactgacatcgccattctcgttgtt
gctgcagatgacggcatcatgcctcagaccattgaggctttgaaccacgcacaggcagct
aatgtgcctatcgtggttgccgtcaacaaggtggacaagcctgatgcgaaccctgcaaag
gttcgtcagcagctcaccgagtacaacctcgtagccgaagaatacggtggagacgtcatg
ttcgttgacgtatctgcactttctggtttgggtattaccgaacttctggatgctgttcta
ctaaccgcagatgcaggtctggatctgcgcgctaaccccaataaggacgcccgcggtatc
gctattgaagctcgtctggacaagggtcgcggtgctgtcgctaccgtgctcattgagtct
ggaactcttcgcgtcggtgacgccatcgtggcaggtactgcctacggtcgcgttcgtgcc
atggtggacgagaacggcactgcagttgaagcagcaaccccatcacgtcctgtccaggtt
cagggtctgtcttcagttcctcgcgccggtgacaccttcctggttaccgaagatgaccgt
actgctcgtcagatcgctgaaaagcgtgaggccgctgaacgtaacgctcagctggctaag
gctcgtaagcgcatctcgcttgaagacttcaccaaggcacttgaggatggcaaggttgaa
tctctcaacctcatcatcaagggtgacgtttccggtgctgttgaagctctggaagagtcc
ttgctcaagattgaggttgatgagagcgtacagttgcgcatcatccaccgcggtgttggt
gctgttaccgaaagcgatgtcaacctggcaacagtcgacaacgcagtcatcatcggcttc
aacgttcgacccgacaccaaggcacgcgagcgtgctttgcgtgaaggtgttgatatccgc
ttctactcggtcatctactcagcactggaagatattgagaactccctcaagggcatgctc
aagccagagttcgaagaagttcagtccggtgttgcagagattcgcgaaatcttccgctcg
agcaagttcggcaacattgctggatgtatcgtgcgcagtggaacgattacacgtaactcg
aaggcacgcgttatccgcgagggtatcgttatcgccgatggcctggccatcgagtctctg
cgtcgcttcaaggacgatgccaccgaagtcaagactgacttcgaatgtggtatcggtctg
ggtaagtacaacgacatccaaatcggcgatgagatcgagaccatcgaactcaaggaaaag
ccccgcgtctaa

DBGET integrated database retrieval system