KEGG   Alligator mississippiensis (American alligator): 102557878Help
Entry
102557878         CDS       T03087                                 

Gene name
TIMP3
Definition
(RefSeq) TIMP metallopeptidase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amj01002]
    102557878 (TIMP3)
Peptidases and inhibitors [BR:amj01002]
 Peptidase inhibitors
  Family I35: timp family
   102557878 (TIMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 102557878
NCBI-ProteinID: XP_006271730
UniProt: A0A151NI29
LinkDB All DBs
Position
Un
AA seq 212 aa AA seqDB search
MPAGWLSLLALLCSWSLSALVAEACTCVPIHPQDAFCNSDIVIRAKVVGKKLMKDGPFGT
MRYTVKQMKMYRGFQIMPHVQYIYTEASESLCGVKLEVNKYQYLITGRVYEGKVYTGLCN
WYEKWDRLTQAQRKGLNHRYHLGCGCKIRPCYYLPCFVTSKSECIWTDMLSSFGHSGYQS
KNYACIQRVEGYCSWYRGWAPPDKTIINATDP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgggtggctcagcctcctggcgctcctctgcagctggagcctgagcgccttg
gtggcggaagcgtgcacgtgcgtgcccatccacccgcaggatgccttctgcaactcggac
atcgtcatccgggccaaagtggtggggaagaagctcatgaaagatggaccttttggaaca
atgcgatacaccgtcaagcagatgaagatgtacagaggctttcagattatgccacatgtt
cagtatatctacacagaagcctctgaaagtctttgtggtgtcaagttggaggtcaacaag
tatcagtatctgattacaggccgggtgtatgaaggaaaggtttacactggtctgtgtaac
tggtatgagaaatgggacagactgacccaagcccaacgcaaaggactaaatcatcgttac
cacctgggctgtggatgcaagattaggccttgctactacttgccctgctttgtcacctct
aagagtgagtgtatttggacagatatgctctccagcttcggccattcaggataccaatca
aagaactacgcctgcatccagcgggtggaaggttactgcagctggtacagaggatgggca
cctcctgataaaactatcatcaatgccacagatccgtga

DBGET integrated database retrieval system