KEGG   Alligator mississippiensis (American alligator): 102558284Help
Entry
102558284         CDS       T03087                                 

Gene name
PTEN
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00562  Inositol phosphate metabolism
amj01100  Metabolic pathways
amj04068  FoxO signaling pathway
amj04070  Phosphatidylinositol signaling system
amj04115  p53 signaling pathway
amj04140  Autophagy - animal
amj04150  mTOR signaling pathway
amj04218  Cellular senescence
amj04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102558284 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102558284 (PTEN)
   04070 Phosphatidylinositol signaling system
    102558284 (PTEN)
   04150 mTOR signaling pathway
    102558284 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102558284 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102558284 (PTEN)
   04218 Cellular senescence
    102558284 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102558284 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amj01009]
    102558284 (PTEN)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102558284 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     102558284 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     102558284 (PTEN)
Protein phosphatases and associated proteins [BR:amj01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    102558284 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 102558284
NCBI-ProteinID: XP_014463305
UniProt: A0A151NZY3
LinkDB All DBs
Position
Un
AA seq 403 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIFTSPSGPSRREDKYMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIGLDENLDKVENGSLVGDQEL
DGIFSTERSDNDKEYLILTLTKNDLDKANKDKANRYFSPNFKVKLFFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcatcaaagagatcgtcagcaggaacaaaaggcgataccaggaggatggc
ttcgacttggacctgacctatatttatccaaacataattgctatgggttttcctgcagag
aggcttgaaggagtgtaccgtaacaacattgatgatgtagtaaggtttttggattcaaaa
cataaaaaccattacaagatatacaatctatgtgcagaaagacattatgacaccgccaaa
tttaattgcagagttgcacagtacccttttgaagaccataacccaccacagttagagctt
atcaaacctttttgtgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca
gcaatccactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttatta
catcgaggcaagtttttaaaggcacaagaagccctagacttctatggagaagtaaggacc
agagacaagaagggagtaactattcccagtcagagacgctatgtgtattactatagctac
ttgttaaagaatcacctggattacagaccagtggcactgctgtttcacaagatgatgttt
gaaacaattccaatgttcagtggcggaacttgcaatcctcagtttgtggtgtaccagcta
aaggtaaagatattcacctccccttcaggaccctcaagacgtgaagacaaatatatgtac
tttgaattccctcaaccattgccggtgtgtggtgatatcaaggtggagttcttccacaaa
cagaacaagatgttgaaaaaggacaaaatgtttcacttctgggtaaatacattcttcata
ggactggatgaaaatttggacaaagtagaaaatggaagtctagttggagatcaggaactt
gatggtattttcagtacagagcgctcagataatgataaggaatatctaatccttacatta
acaaagaacgatctagacaaggcaaataaagacaaagccaacagatatttctctccaaat
ttcaaggtgaagctatttttcacaaaaacagtagaagagccatcaaatccagaggctagc
agttcaacttcagtaacaccggacgttagtgacaatgaacctgatcattatagatattct
gacaccactgactctgatccagagaatgaaccttttgatgaagatcagcatacgcagatt
acaaaagtctga

DBGET integrated database retrieval system