KEGG   Alligator mississippiensis (American alligator): 102558321
Entry
102558321         CDS       T03087                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
amj  Alligator mississippiensis (American alligator)
SSDB
Motif
Pfam: Nore1-SARAH RA Sec5 Ras_bdg_2 DUF5663
Other DBs
NCBI-GeneID: 102558321
NCBI-ProteinID: XP_006266457
LinkDB
Position
Un
AA seq 275 aa
MREGEVAAAAAAACFDMTWSSTASSGYCSQEDSDSELEQYFTARTSFARKPQRAKDEQID
WEKPVLSQAEIEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPATKKTPT
IHDAKKVARSQAVKRRTSFYLPKDTVKHLHIISRTRASEVIEALLKKFMVVDNPRKFALF
ERSEKEDQVYLRKLPDDEQPLRLRLLAGPSEKVLSFVLKENETGEVNWDAFSMPELHNFL
RILQREEEEHVRQILQKYAHCRQKMQEALATRTPG
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcgcgagggcgaggtggcggcggcggcggcagcggcctgcttcgacatgacgtggagc
agcacggccagcagcggctactgcagccaggaggactcggactcggagctggagcagtac
ttcacggcgcgcacctccttcgcgcgcaagccgcagcgcgccaaggatgagcagattgac
tgggagaagccagttctgagccaagctgagattgagcagaagataaaggagtacaacagt
caaatcaacagcaacctcttcatgagcctgaacaaagatggctcctacacgggtttcatc
aaggtgcagctgaagctggtccggccagtctctgtgccagccaccaagaagacacccacc
atccatgatgccaagaaggtggcacgctcccaggcggtgaagcggcgcacatcattctac
ctgcccaaggacacagtcaagcacctgcacatcatctcccgcacgcgggccagtgaggtc
attgaggccctgctcaagaaattcatggtggttgacaatccccgcaagttcgctctattc
gagagatctgagaaggaagaccaagtttacttgcggaagttgcctgatgacgagcagccc
ctgcgtcttcggctgctggctggccccagtgagaaggtcctcagctttgtcctgaaggag
aacgagactggggaggtcaattgggatgccttcagcatgcctgagctgcacaacttcctg
cgaatcctgcagcgggaggaagaggagcatgtccggcagatcctgcagaagtatgcccac
tgccgccagaagatgcaggaagcgctggccactcgcaccccaggctga

DBGET integrated database retrieval system