KEGG   Alligator mississippiensis (American alligator): 102559297Help
Entry
102559297         CDS       T03087                                 

Gene name
MGAM, SI
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00052  Galactose metabolism
amj00500  Starch and sucrose metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102559297 (MGAM)
   00500 Starch and sucrose metabolism
    102559297 (MGAM)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102559297 (MGAM)
    3.2.1.20  alpha-glucosidase
     102559297 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102559297
NCBI-ProteinID: XP_019347375
LinkDB All DBs
Position
Un
AA seq 1817 aa AA seqDB search
MGKKKFSNLEILLIALFCLAVIITCVLIGLVATGQSGVKEGQEDFSPECPVTDIGERINC
IGDNQAATKSLCVLRGCCWSPVNDSNIPWCFFSRNHGYQVVGGQKPKNTGFEATLTRLSS
PSLFGNDINKVLLTGEYQTANRFHFKITDPNNKRFEVPHENVKPFAGPAVSVLKYKVSIA
ENPFGIIVTRVSNSKTLFNTSIGPLVYADQYLQLSIKLPSSNIYGVGEHVHKQYRHDVNW
KTWPIFTRDAAPIGDMNNLYGAQTFFLCLEDNTGASFGVFLMNSNAMDFTLQPAPAVTYR
TTGGVLDFYVFLGNTPEEVVQEYLKLIGQPSMPSYWSLGFQISRWNYGSLDEVKAVVDRN
RAIGIPYDVQYTDIDYMENKKDFTYDKVKFKDLPNFAIDLHNHGQKYIIILDPAISINPL
INGTYDAYERGQSKAVWVNESDGVTTLIGEVWPGLTVFPDFTNPDCTTWWTEECKIFHDQ
VQYDAIWIDMNEVSSFIRGSTRGCQQNNLNYPPFTPRILDGLMYSKTICMDAVQAWGKHY
DVHSLYGYSMTLSTEKAIQTVFPGKRSLILSRSTFAGSGKFTGHWLGDNFATWNDIKWAI
PGMLEFNLFGMPYIGADICGFVYDTTEELCRRWMQVGAFYPFSRNHNAEYNIPQDPAAFG
ADSLLVRTSRHYLNIRYTLLPYLYTLFYKAHTQGSTVVRPLLHEFYSDEATWAIDRQFLW
GPGLLITPVLDPGVDKVTAYIPDAVWYDYETGERPLWRKQQVEMYLPADRLGLHLRGGYI
FPTQQPANTTVYSRKKSLGLIIALDDNGQATGDLFWDDGESRGTVENNNYISYQFSVSNN
TLTMNVLHMNYTDPNNLIFEEIKIFGLAFTPTLLTVSQNGVMQNSSHSVIYNPSNKVTNI
TGLKLELGKSYVLSWAQVFSDNDRFDCHPAPDATAEKCQALGCIWNNQTVTQNVPYCYYP
PSNGYYVKQIQYSSSGLTANLSTNTNYVKNSRSFTTPIDTLTLEVKYHENNLLQFKIYDY
NSRRYEVPIPLNISSSPGSTAENRLYEVSIQNEPFGIQVRRKSTGTVIWDSQLPGFTFSD
MFIQISTRVPSQYVYGFGENEHNKFRRDMNWHTWGMFTKDQPPGYKLNSYGFHPFYMGLE
NDGNAHGVLLLNSNAMDVIFQPTPALTYRTIGGILDFYLVLGPTPELVVQEYTSLIGRPV
MPSYWALGFQLCRYGYKNDTEVSDLYEAMKKAQIPYDVQYTDIDYMERQLDFTLSPHFSG
LPKLVDKMKAEGMRFIIILDPAISGNETNYLAYTRGLQNDVFIKWPDSNDIVWGKVWPDY
PNVTVNDSLPWETQVELYRAYAAFPDFFRNTTAQWWETEIREYHTNPTQPEKSVKFDGLW
IDMNEPASFVNGAVGGCRDATLNYPPYMPHLESQSLGLNHKTLCMESQQFLPDGSPVRHY
DVHNLYGWSHAKPTYDALQKVTKERGIVITRSTYPSSGRWTGHWLGDNTAAWNQLYKSII
GMLDFSLFGISYTGADICGFFQDTEYQMCARWMQLGAFYPFSRNHNGKGSMRQDPAAFDE
AFQNISRNVLNTRYTLLPYLYTLMYGAHAHGSTVVRPVLHEFVEDKTTWDVYKQFLWGPA
LLISPVLDPNATSVEAYIPNARWYDYYTEMYIGFRGQFSNFSAPLEHINLHIRGGYIIPW
QYPAANTALSRRNSMGLTVALDDNGLAQGQLYWDDGNSIDAYENNVFLLETFNASQDVLT
ITVSHNGYADPNALKFSDIKILGVSKNPLNVIIKQNGVNLPSAHNISYSTEKQVLHITQL
QLELGQDYSVEWKASNN
NT seq 5454 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaaaaagttcagtaaccttgaaatcttgctgatagccctgttctgtttggca
gtgattataacctgcgttctgattggacttgtagcaacagggcagtctggagtcaaagaa
ggtcaagaagacttttctccagaatgcccagtgacagacataggagaaagaatcaactgc
attggagacaatcaagcagcaacaaagagcctatgtgtgctgcgtggctgttgctggagt
ccagtcaatgactcaaacataccctggtgtttcttctccagaaatcatggataccaagtg
gtgggaggtcaaaaacctaaaaatacaggttttgaagctactttaacaaggctatcttca
ccttccctgtttggaaatgatatcaataaagtcctcctcactggagagtatcagacagca
aatcgcttccatttcaagattacagatcctaataataaaagatttgaagtcccacatgag
aacgtgaaaccttttgctggacctgcagtatctgttttaaagtacaaagtcagtattgct
gagaatccttttggcatcatagtgaccagagtaagcaacagcaaaaccctgtttaataca
agcataggaccccttgtgtatgctgaccagtatttgcagctctccataaagctacccagc
agcaacatttatggggtaggagaacatgtgcacaagcaatatcgacatgacgttaactgg
aaaacgtggcccatctttaccagggatgctgcacccattggagacatgaataacttgtat
ggagctcaaacattttttttgtgtttggaagataataccggagcctcttttggtgtcttt
ctaatgaatagtaatgccatggattttactcttcagcctgccccagcagtaacctataga
acaactggtggagttctagatttttatgtcttcttaggaaacactccagaggaagtggtt
caggagtatctgaagctaataggacagccttcaatgccttcatactggagccttggattc
caaattagtcgctggaattatggatctcttgatgaagtgaaagcagtagtagacaggaac
agagcaattgggataccttacgatgttcaatacacagatattgactatatggagaacaag
aaagacttcacttatgataaagtgaaatttaaagatctccccaactttgctattgaccta
cataatcatggacaaaaatacatcatcatactggaccctgccattagcataaacccgctc
attaatggtacctacgatgcctatgaaagaggacagagcaaggcagtctgggtaaatgaa
tcagatggagtgacaacactcatcggagaggtatggccaggactgactgtgttcccagat
ttcaccaatccagactgtaccacttggtggactgaagaatgcaagatttttcatgatcaa
gtacaatatgatgcaatctggattgatatgaatgaagtatccagctttattagaggttcg
acaagaggctgtcagcaaaacaacttaaactatccacctttcactcccaggattctggat
ggactcatgtattcaaagacaatttgcatggacgcagtgcaagcttggggcaagcactat
gatgttcacagtctatatggatattccatgaccctgtctactgaaaaagccatccaaact
gttttccctggaaaaagaagcctcattctttctaggtctacctttgctgggtcaggaaaa
ttcacaggacattggctgggagataattttgcaacttggaatgacattaaatgggcaata
ccaggcatgctggaatttaatctctttggaatgccttatattggagcagatatttgtggg
tttgtctatgatactacagaagaactttgtagacggtggatgcaagtgggagcattttac
cccttttccaggaatcacaatgctgaatataatatacctcaagatcctgctgcatttgga
gcagattctcttctggtaaggacgtcaaggcactacttgaacattcgctacactttgctg
ccgtacctctacaccctcttttacaaagctcatacgcaaggaagcacagttgtgaggcca
cttcttcatgaattctattcagatgaagcaacatgggctattgataggcagttcttatgg
ggtcctggactactcatcactcctgtactggacccgggtgtagacaaagtgacagcatac
attcctgatgcagtgtggtatgattatgagacaggtgaaagaccattgtggagaaaacaa
caggttgagatgtatctcccagcagacagactaggacttcatctgaggggaggctacatc
tttcctactcagcaaccagctaatacaacagtttacagtcgtaagaaatcgttgggactt
atcattgcattagatgacaatggtcaagcaactggagacttattctgggatgatggagaa
tctagaggtactgtggaaaataacaattacatttcctaccagttttcagtttcaaataat
actttaacaatgaatgttttgcacatgaactacactgatccaaacaatttaatatttgag
gaaatcaaaatttttggattggcttttacaccaactctgcttactgtgtctcagaatgga
gtgatgcagaattcttctcatagtgtcatctataatccttcaaataaggtcaccaacata
acagggcttaagctcgaactaggaaaatcttatgtactatcatgggctcaagtgttcagt
gacaatgacagatttgattgtcatcctgctcctgatgcaacagcagaaaaatgccaagcc
cttggctgcatctggaataaccaaactgttacacagaacgttccctactgttactaccct
cccagcaatggttattatgttaagcaaattcaatattcttcttcaggtttaacagcaaac
ctgagcacaaatactaattatgttaagaattcacggtcttttactacaccgattgataca
cttaccttggaagtgaaatatcatgaaaataatttattgcaatttaagatttatgattac
aacagtagaaggtacgaggttccaataccactaaatatctctagcagccctggaagtaca
gctgagaatagactctatgaagtatcaattcagaatgaaccatttgggatccaggttcga
cgcaagagcacaggaacagttatttgggattctcagttacctggcttcacttttagtgat
atgtttattcagatttcaacccgtgtcccatcacagtatgtatatggatttggtgaaaat
gaacataataagtttcggcgtgatatgaactggcacacctggggaatgttcacaaaagac
cagcctcctgggtacaaattgaattcttatggtttccatcccttttacatgggcctggaa
aatgatggaaatgctcatggagttctattgctgaacagtaatgcaatggatgtaatattc
cagccaactcctgctctgacgtaccgtactattggaggaattctggacttctacctggtt
ttgggccccactccagagcttgttgttcaggaatacacttcactaatagggcgaccagta
atgccatcctattgggctttgggattccagttatgccgttatggatacaaaaatgatact
gaagtctctgacctgtatgaagcaatgaagaaagctcagataccctatgatgtacaatac
acggatatcgattatatggaaaggcagttagacttcactcttagcccacacttctctgga
ttgccaaaacttgttgacaaaatgaaagcagaaggaatgagattcatcattattctggat
ccagcaatttctggaaatgaaaccaattatctagcctatacaaggggcttacagaatgat
gtctttatcaagtggcctgatagtaatgatatcgtatggggaaaggtctggccagattat
cctaatgttactgttaatgattccttaccctgggaaacccaagtggaactgtacagagct
tatgcagctttcccagacttcttccgtaacaccacagctcaatggtgggaaacggaaata
agagaatatcacactaatcctactcagcctgaaaaaagtgtaaagtttgatggcctttgg
attgacatgaatgaaccggcaagttttgttaatggtgcagttggaggctgtagagatgca
acactaaattatcctccgtatatgccacatttggaatcacagtcacttggattgaatcac
aaaaccttgtgcatggaaagtcaacagttcctgccagatggaagtccagttagacattat
gatgtgcataatctctatggatggtcacatgctaaacctacctatgatgctttacagaag
gtcacaaaggaacgtggaattgtcatcacccgttcaacatatccatccagtggaagatgg
actggacactggcttggtgataatactgcagcttggaatcaactttataaatctattatt
ggtatgttggattttagcctctttggaatatcctatactggagcagatatctgtgggttc
ttccaggatacagaatatcaaatgtgtgcccgctggatgcagctgggagccttttatcca
ttttctagaaatcacaatggtaaaggatcaatgaggcaagatcctgctgcctttgatgaa
gcatttcaaaatatttccaggaatgtactcaatacaagatacacattgttaccctatctc
tacacattaatgtatggagcccatgcccatggtagcactgtagttcgtcctgttctccat
gagtttgtggaagacaaaacaacatgggatgtgtacaagcagtttctctggggacctgca
ctactcattagccctgtattggatccaaatgctacatctgtagaggcttatatacccaat
gcacgctggtatgattattatacggaaatgtatattggcttcaggggacaattcagtaac
ttttcagctcctcttgaacatatcaaccttcacatccgaggtggttacatcattccctgg
caataccctgctgctaataccgctttaagtcgaagaaactcaatgggacttactgtcgct
ttggatgataatggacttgctcaaggtcagctgtattgggatgatgggaacagcattgat
gcatatgaaaataatgttttcctgttagaaacatttaatgctagccaggatgttctaaca
atcacggtttcgcacaatggctatgctgaccctaatgcattaaagtttagtgacattaaa
atcctgggagtttccaaaaaccctttgaatgttataattaaacaaaatggagtgaacctt
ccgtctgctcataatatcagttacagtaccgaaaaacaggttctgcatataactcagctt
caacttgaactagggcaagactactcagttgaatggaaggcttcaaacaattag

DBGET integrated database retrieval system