KEGG   Alligator mississippiensis (American alligator): 102560733
Entry
102560733         CDS       T03087                                 

Gene name
NR3C1, GR
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102560733 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amj03000]
    102560733 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:amj03310]
    102560733 (NR3C1)
Transcription factors [BR:amj03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102560733 (NR3C1)
Nuclear receptors [BR:amj03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102560733 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102560733
NCBI-ProteinID: NP_001274234
UniProt: L8B570
LinkDB
Position
Un
AA seq 780 aa
MDPKESLNSSEREEAGKIVRFNDKGGIVMDFHPTFRGGATVKASASTSPLPASTSPLPAS
SQSDSKQQPVLGDFSKGLVSNVPQPDLSKAVSLSMGLYMGETDSKVMGNDIGFPQQGQIG
ISSGETDFRLLEESIASLNKSSGLAEGTKGTVSSGLSLKQDFPVMTNCNVPLEPGTLMQG
QIGSSGGNMKLFSEDQSTLDILQDLELPPISPGKEPNGSPWRLDPLLDEGGLLSPLAADE
AFLHEGNSGEDCKPLILPDTKPKINERGDLLSSPPVQMPQVKTEKEDFIELCTPGIKQEK
TGPVYCQANFPGSSVLGTKVSAISVHGVSTSGGQIYHYDLNTASHSQQQDQKPVFNVIPS
LTAGTENWNRCQGSGDDPLSPMGNLNFSGRSSFSNGYSSPGMRSDVSSSPSTTSATTGPP
PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
YRKCLQAGMNLEARKTKKKIKGIQQSNVSSVRDTPESPGNKSIVPASLPQLTPTLVSLLE
VIEPEVLYSGYDSTLPDSSWRILSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQ
YSWMFLMSFALGWRSYKQSNGNLLCFAPDLIINEQRMSLPCMYEQCKNMLMVAGELSRLQ
VSYEEYLCMKTLLLLSTIPKEGLKSQALFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQ
LTKLLDSMHEVVENLLNFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggatcccaaagaatcgctgaactcctcagagagagaggaagcagggaaaattgtgcgc
ttcaatgacaaaggagggattgtgatggattttcatccaacctttaggggtggagctacc
gtcaaggcttctgcgtctacatctcccctgcctgcgtctacatctcccctgcctgcgtct
tctcagtcagactccaaacagcaacctgttttgggtgacttttcaaaaggattagtaagt
aatgtgcctcagccagatctttccaaggcagtgtcgctctcaatgggactgtacatgggt
gagacagattcaaaagtaatgggaaatgacattggatttccgcagcagggccaaatcggc
atctcttctggagaaacagacttcaggctcctggaagaaagcattgcaagcttgaacaag
tcctctggtctggcagagggcactaaggggacagtgtcttctgggttgtcactcaagcag
gacttcccagtcatgactaactgcaatgtccctttagagccaggaacattaatgcagggc
cagattggctctagtggtggcaacatgaagttgttctctgaggaccaaagcaccctggat
attctgcaagatttagaattgccaccaatctcgccgggtaaagagccaaatggaagcccg
tggagacttgacccattactagatgaaggtggcttgctttcccctctagctgcagatgag
gcatttctccacgaaggaaattcaggtgaagactgcaagccactcatcttaccagacact
aagcctaaaattaatgagcgtggagatctcttgtccagtcccccagtgcagatgcctcaa
gtgaagacggagaaggaagacttcattgaactctgtaccccaggcataaagcaagagaaa
acaggcccagtttattgtcaagctaattttcctgggtctagtgtactgggtactaaagtg
tctgccatttctgtccatggtgtcagtacctctggaggacagatatatcactatgacctg
aatactgcctctcactcacagcagcaggatcagaaaccagtttttaatgtcattccatct
cttactgccggtacagaaaattggaataggtgccagggatctggggatgaccctctatct
cctatgggaaatttgaacttttctggcagatcttctttctctaatggctattcaagccct
ggtatgagatctgatgtaagctcttctccgtccaccacctcagcaactacaggaccgcct
cccaagctgtgtcttgtttgctctgatgaggcttctgggtgtcattatggtgttctaact
tgtggcagctgcaaagtgttcttcaaaagagctgtagaaggacaacacaattacctgtgt
gctggaagaaatgattgtatcattgacaaaatccggagaaaaaactgtcccgcatgccgc
taccggaaatgtctgcaagctggcatgaacttagaagctcgaaaaacaaagaagaagata
aaaggaattcagcagtccaacgtgtcatcagtgagagatactcctgaaagtcctggaaat
aagtctatagttcctgcatcactgccacagctaacccctaccctggtttccctgctggaa
gtcattgaaccggaagttttgtattcaggctatgacagtacgctacctgactcaagttgg
cgtatattgtcaactctcaacatgttaggaggacgacaagtggtagctgcagtaaagtgg
gcaaaggcaataccaggtttccgaaatctacatctggatgaccaaatgacccttttgcag
tactcctggatgttcctgatgtcttttgctttaggatggagatcatacaaacagtcaaat
ggaaatctgctgtgttttgcaccagatctgattattaatgaacagagaatgagcctgcca
tgtatgtatgaacagtgcaaaaatatgcttatggttgctggggagttatcacggcttcaa
gtttcatatgaagaatatctctgcatgaaaaccttgctgcttctttctacaattcctaag
gagggcctgaaaagtcaagctttgtttgaagaaattcgtatgacatacattaaagagctg
gggaaagccatagtgaagagagaagggaactcgagccagaactggcagcggttttatcaa
ctgactaagcttttggattccatgcatgaagtggttgaaaatcttctgaacttttgcttc
caaacgtttttggataaatccatgagtattgaattccccgagatgttggccgaaatcatc
agcaatcagataccaaaatattcaaatggaaatatcaagaagctcttatttcatcaaaag
tga

DBGET integrated database retrieval system