KEGG   Alligator mississippiensis (American alligator): 102561220Help
Entry
102561220         CDS       T03087                                 

Gene name
RNPEP
Definition
(RefSeq) arginyl aminopeptidase
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amj01002]
    102561220 (RNPEP)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     102561220 (RNPEP)
Peptidases and inhibitors [BR:amj01002]
 Metallo peptidases
  Family M1
   102561220 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2 Sec7
Motif
Other DBs
NCBI-GeneID: 102561220
NCBI-ProteinID: XP_019348100
LinkDB All DBs
Position
Un
AA seq 642 aa AA seqDB search
MAMEEAAAAAGGRRLQDVASACSADSFELLHLHLALRAAFAPPGXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAALARDGRPDLQPLRVQSRPFARYGSALHLALPEPLR
AGERLALEVSYSTGDGPGVCWLTPEQTAGKQKPYMYTQGQAVLNRSFFPGFDTPAVKSTY
SATIKVPEGFTAMMSATTWEKQEKDNTFIFKMSQPIPSYLIALVIGDIVSAEVGPRSHVW
AEPCLIEAAKKEYDGVIEEFLVVGEKLFGPYVWGRYDILFMPPSFPFGGMENPCITFVTP
CLLAGDRSLVDVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTVVFGAAYTCL
EATTGRALLRQHMDNTGEDHPLNKLRVKIEPGVDPDDTYNETPYEKGYCFVSYLAHLVGD
QSKFDTFLQAYVNQFKFQSIMADDALNFFLEYFPDLKKKGVDSIPGFEFDRWLNTPGWPP
YLPDLSPGDVLMKPAEDLAELWAASSLDMEAVKAVDISAWKTYQLVHFLDKVLQKSPLPD
GNVDQLSEKYPKISQAQNAELRLRWCQIVLKNNHEAEYGKVKDFLHSQGKQKYTLPLYRS
MWSGSESARVLATETFSATAPQLHVNVQNYVKKILGLEPAGS
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggaggaggcggcggcggcggcgggcgggcggcggctgcaggacgtggcgtcc
gcctgcagcgccgacagcttcgagctgctgcacctgcacctggcgctgcgcgccgccttc
gcgccgccgggcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnngcgcggcgctggcgcgggacggccgccccgacctgcagccgctgcgcgtccag
agccgccccttcgcccgctacggctccgcgctgcacctcgccctgcccgagccgctgcgc
gccggcgagcgcctggcgctggaggtgtcctacagcacgggcgacgggccgggggtttgt
tggctcactcccgagcagacagcagggaagcagaagccctatatgtacactcaaggccag
gccgtcctgaatagatcctttttccctggctttgacacccctgcagttaaaagtacatat
tcagccacaataaaggtccctgagggcttcacagctatgatgagcgctacgacctgggag
aagcaggagaaagacaacacattcatcttcaagatgtcccagccaattccctcctacttg
attgctttggttattggtgacattgtttctgctgaagttggtccaaggagccatgtctgg
gctgagccatgtctgattgaggcagctaagaaggagtatgacggcgtgattgaagagttc
ctggtggttggggagaagctatttggaccatatgtttggggcaggtacgacattctgttc
atgccgccgtcgttcccctttggtgggatggagaacccctgcatcaccttcgtgaccccc
tgcctgttggctggagaccgctccctggtggatgtcatcatccacgaaatctcccacagc
tggtttggcaacttggtcaccaatgccaactggggggagttctggctgaatgagggcttc
accatgtacgcgcagagaaggatctccactgtggtgtttggtgctgcctatacttgccta
gaagcaacaacgggaagggccttgctacgacagcacatggataacactggagaagatcac
ccattaaacaagcttagagtgaagattgaaccaggcgtcgaccctgatgacacctacaat
gaaaccccctacgagaagggatactgtttcgtgtcctacctggcgcacctcgtgggagat
cagagcaaatttgataccttcttgcaggcctacgtgaaccagttcaagttccagagcatc
atggctgatgatgccctaaacttcttcctggagtacttcccagacctgaagaagaaaggc
gtggactccatcccaggctttgagtttgatcgttggctgaacacccccggctggccccca
taccttcctgacctctcacccggagatgtgctgatgaagccagcagaggacctggcagaa
ctgtgggcagccagcagcttggacatggaggcagttaaggctgtggacatctctgcctgg
aagacatatcagctggtacacttcctggataaagtcttgcagaaatcacctttgccggat
gggaatgtggaccagctgagcgagaagtacccaaagatctcccaggcacagaatgctgag
ctgcgcctccgctggtgccagatcgtcctcaagaacaaccatgaggccgagtatggaaaa
gtcaaggactttctgcacagccaggggaagcagaagtacaccctccccctctaccggtcc
atgtggagcggctctgagtcggcccgggtgctggccacggagaccttctcagccacggct
ccgcagcttcatgtgaatgtccagaactacgtcaagaagatcctgggcctggagcctgct
ggcagctag

DBGET integrated database retrieval system