KEGG   Alligator mississippiensis (American alligator): 102561500
Entry
102561500         CDS       T03087                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04210  Apoptosis
amj04620  Toll-like receptor signaling pathway
amj04621  NOD-like receptor signaling pathway
amj04622  RIG-I-like receptor signaling pathway
amj04623  Cytosolic DNA-sensing pathway
amj04625  C-type lectin receptor signaling pathway
amj04920  Adipocytokine signaling pathway
amj05132  Salmonella infection
amj05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102561500 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102561500 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102561500 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102561500 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102561500 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102561500 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102561500 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102561500 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102561500 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102561500 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102561500 (IKBKG)
Protein kinases [BR:amj01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102561500 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO AnfG_VnfG Fez1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 102561500
NCBI-ProteinID: XP_006274309
LinkDB
Position
Un
AA seq 553 aa
MSGTRRRRSADMVAPGGGDGAGPAGDADANALPQAPDPEAWQRLAAENQDLKEALRQGNQ
ALRLRCQEFQQVQAMRREERDFLLLRFHEARTLVQQLQNEQLEVRRQLEWLRSACQPPSL
LCTLEPAGLDEADTVTLTHETPVALMALDRSKENQAVLKEADTLLLGEKPLHNQTQQQRL
LVKESGTLAEQLLKTESLQGAGNNRIRDDQAEELHRKLEETENKCAELKQQLASAREDLS
QLKAQGQETEQQFQALRKQLEQVTEDRVSVKAQVTSLLGELQESQSRLETCMHEKQALAE
RARTAVEQCRRLEGDVEALQEQHGVQLDQLRLQAQNLETALRVERQGATEEKRKLAQLQV
AYHQLFQEYDSHIKNSIEGEKRAQALEWQLDELSQQLQQAEEALVAKQELIDKLKEEAER
HRAVLETIPVLKAQADIYKADFLAERQAREQLHGQREDLQEQLVTLQRDYEVLKADAAGT
TRALMEEMRNRHSEVRPPLPVPPTAYPLAVGPYQAAPHQGSISEEQPDFCCPKCQYQAPD
MDTLQIHVMDCIK
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgagcgggacccgccggcggcgcagcgcggacatggtggcgcccgggggcggtgatggg
gccggccccgcgggtgatgctgacgccaacgccctgccccaggcgccggaccccgaggcc
tggcagcgcctggccgcggagaaccaggacctcaaggaggctctgcggcagggcaaccaa
gcgctacggctgcgatgccaggagttccagcaagttcaggccatgcggcgtgaggagcgt
gacttccttctgctgcgcttccatgaggcccgcaccctggtgcagcagctgcagaatgaa
cagctggaggtgcggcgacagcttgagtggttgcgcagcgcctgccagcctccatccttg
ctatgcaccctggagccagctgggctggatgaggctgacaccgtgactctcacccatgag
acgcctgtagcgctgatggctcttgaccgtagcaaggagaaccaggcagtgctgaaggaa
gcagacactctcctgttgggagagaagccactgcataaccagacccagcagcagaggctg
ctggtcaaggagagcggtaccctagctgagcagctcctgaagactgaatccttgcaaggg
gctgggaacaacaggatcagagatgaccaggctgaggagctgcacaggaagctagaggaa
actgaaaacaagtgtgctgagctgaagcagcagctggcatcagccagggaggacctgagc
caactgaaagcacaggggcaggagacagagcagcagttccaggccctaagaaagcagctg
gagcaggtgacagaagacagggtctcggtgaaggcccaggtgacctcactgctgggtgag
ctgcaagagagccagagccggctggagacctgcatgcatgagaagcaggcactggcagag
cgggcacggacagctgtggaacagtgccgacggctggagggggacgtggaggctctgcag
gagcagcatggggtgcagctggaccagctgcggctacaggcccagaatttggagacagca
ttgcgtgtggagcggcagggcgccacggaggagaaacggaagctggcacagctgcaggtg
gcctatcaccagctcttccaggaatatgacagccacatcaagaacagcatagagggcgag
aagagggcccaggccttagagtggcagttggatgagctgtcgcagcagctgcagcaggca
gaagaggcactggtagccaagcaggagctgatcgacaagctcaaggaggaggctgagcgt
caccgggctgtgctggagaccatccccgtgctcaaagcccaggctgacatctacaaggct
gacttcctggcggagcggcaggcacgggagcagctgcatggtcagcgtgaggacctgcag
gagcagctagtaactttgcagcgtgactatgaggtgctaaaagctgatgctgccggcacc
acgcgggccctgatggaggagatgcggaaccgacactcagaggtgcgcccacctctgcct
gtgcccccaacagcttaccccctggctgtggggccataccaggctgcaccgcatcagggg
agcatctctgaggagcagccagatttctgctgccccaagtgccagtatcaggcacccgac
atggacacacttcagatccacgttatggactgcatcaagtga

DBGET integrated database retrieval system