KEGG   Alligator mississippiensis (American alligator): 102561875
Entry
102561875         CDS       T03087                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102561875 (CACNA1E)
   04020 Calcium signaling pathway
    102561875 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amj04040]
    102561875 (CACNA1E)
Ion channels [BR:amj04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102561875 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102561875
NCBI-ProteinID: XP_019355822
LinkDB
Position
Un
AA seq 2442 aa
MLGLGPCTASAHTLSETSSFTTGGVTELDTDSQRYVLALPEEETWRKHRLGLMQTTQSCN
LLEPESLTEALVSRTASFDALYELRSREGEGSLGFEGGSTFDLGLSQYIPVSPDVIKRRR
GGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGSADGGSEQSRSRPGAAA
PAGGTPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEDNVVRKYAKKLIDWPP
FEYMILATIIANCIVLALEQHLPGDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVF
HKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIV
LKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYANNSGELEELDPPHPCGV
QGCPPGYECKEWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLY
FIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKA
EEVMLAEENKNAGTSALEVLRRATIKRNRTEAMNRDSSDEHCVDISSVGTPLARSSIKSA
KVDGASYFRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPLWLTHLLYY
AEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISV
LRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFN
FMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIILTLFG
NYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPTVERDR
RRRHHMSMWEPRSSQLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLLNPHAS
IFRRKKPGENVASDKPEEEQGGKAEQPQVEGLEQPTTGTNVSASEDKRSPSPRAKRERDQ
WHQKSCHGNCDPTEQDGSGGGGSGFEDRARLRQSQRRSRHRRVRTEGKEPAGALESRSTS
QDTGLEDANPAEGQQKRNEGGKEENLIQGEQAGEELKRTNGIPANEAEVPGATKDRSPPK
VPHELNQGNNVSLTEQDCSSLDTSDQALLGGLQMEMSRAISRSEPDLSSITANTEKATES
TTIMIDVQDSTVVQISNKTDGEASPLKEAETKEDEEEAEKKKRKKEKSSETGKAMVPHSS
MFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVTVLRYFD
YVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRD
IKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQL
FKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVST
GEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQG
DKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIAL
NTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITV
IGSITEIILTDTKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQVFGNIKLDEGSHINRHNNFRSFLASLMLLFRSATGEAWQEIML
SCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLT
RDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRL
VLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKM
LDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQE
IISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQEIFQLACMDPTHGQYQEHQSLEPEVR
EFKRVQPSNRGNYLPVDTQERAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRTNS
SWLDEFSMERSSENTYKSRRRSYHSSLQLTARRLNADSGHRSDTHRSGGRERGRSKERKH
LLSPDISRCNSEERSPQADCESPERRRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTS
TPRRGRRQLPPVPPKPRPFISYTSMMQHAGDTSPQPDESEGGSPLLSKALETNDTCLTES
SSSPQGKQSRHSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAP
PMRHSWQMPNGHYRRRRRGAAQGVMCGASIDVLSDTEEDDKC
NT seq 7329 nt   +upstreamnt  +downstreamnt
atgcttggactcgggccgtgcactgccagtgctcacacactctccgagaccagctccttc
acgaccggtggggttaccgagctggacaccgactcccagcgctatgtcctggccctccca
gaggaagagacatggcgcaagcaccggctaggcctgatgcaaaccacccagtcctgcaac
ctgctagagcccgagagcctgacagaggctctggtctcccgcaccgccagttttgatgcc
ctctatgagctgcgatcccgggagggagaagggagcttgggctttgagggaggcagcacg
ttcgacctagggctgagccagtatattccagtgagccctgatgtcatcaagcgccggagg
ggcgggttgatcgagcaacgggacatcatcaaggcccacgaggctcacaagatgcagagc
acaccgcaggcaaggcgcaaggagtgggagatggcgcgcttcggggaggcggtggccggc
cgcctgggctcggcggacggcggctcggagcagagcaggagccgcccaggcgccgcggcc
cccgccgggggcaccccgggagccttcaagcaaaccaaagcccagagggccaggactatg
gctctgtacaaccccatcccggtccggcagaactgcttcaccgtcaacagatccctcttt
ctcttcggggaggataacgtggtgaggaaatacgccaagaagctcatcgactggcctccc
ttcgaatacatgattctggccacgatcattgcgaactgcatcgtcctggcgctggagcag
cacctgccgggggatgacaagacacctatgtcccgaagattagagaagacagagccttac
ttcatcgggatcttttgttttgaagctgggattaaaatcgttgctctgggattcgttttc
cacaagggctcatacctgcggaatggctggaacgtcatggacttcattgtggtcctcagt
ggcatccttgccacagctggaacccacttcaacacacacgtggatctgaggacgctgcgg
gcagtgcgtgtgctcagacctctgaagctcgtctcaggcattcccagtttacagatcgtg
ttgaagtccatcatgaaggccatggtacctcttctccagataggcctgctgctctttttt
gctattctgatgtttgccatcattggcctggagttctacagtgggaagctgcaccgggct
tgctacgcaaataattcaggtgaactagaagagctggaccctcctcatccctgtggagtg
caggggtgccccccgggttacgaatgtaaggagtggattggtcctaacgatgggatcact
cagtttgacaacatcctctttgctgtgttgaccgtcttccagtgcattaccatggaaggg
tggaccacagtgctgtacaacaccaatgatgccttaggagccacctggaactggctgtac
ttcatccccctcatcatcatcggatccttctttgttctcaaccttgtcttgggagtgctt
tctggggaatttgccaaagagagagagagagtggagaaccgcagagccttcatgaaactg
cgacgacagcagcagattgagcgggagctgaacggctacagggcctggatagataaagca
gaggaagtaatgctggctgaagagaataaaaatgctggaacttcagctttagaagtgctc
aggagagctactatcaaaagaaaccggacagaagccatgaatcgtgactcaagtgatgaa
cactgcgttgatatttcctctgtagggacccctcttgctcgctccagcatcaagagtgca
aaagtggatggtgcctcttatttccggcacaaggagcgacttttgcgtatctccgttcgc
catatggtgaaatcccaggtgttttattggattgtcttgagccttgtggctctcaacact
gcctgcgtggccattgtccatcacaaccagccattgtggctcacccacttgctctactat
gcagagttcctgtttcttgggctcttccttttggagatgtccttaaagatgtatggaatg
gggccacgcctttatttccactcctctttcaactgctttgactgtggggtcacagtggga
agcatctttgaagtggtgtgggccatcttcagaccagggacttctttcgggatcagtgtt
ctacgagctctccggcttctgagaatatttaaaataacaaagtattgggcatccctgagg
aatttggtggtctcactgatgagttccatgaagtctattatcagtctgctcttcctcctt
ttccttttcattgtagtctttgctctgttgggaatgcagctgtttggaggcagatttaat
ttcatggatggaactccttctgcaaactttgacacctttcctgcagccatcatgactgtg
tttcagatcctgacaggtgaggactggaacgaagtgatgtacaatggaatccgctcccag
ggaggagtccgctcaggcatgtggtcctccatctacttcatcatcctcactttgtttgga
aactacaccttgctgaatgtgttcttggccatcgctgtggacaacctggccaatgctcag
gagttgacaaaggatgagcaggaggaggaggaggcttttaaccagaagcacgccctgcag
aaagccaaggaagtcagcccgatgtctgccccaaacatgcccactgttgaaagggacaga
aggaggagacaccacatgtcgatgtgggaaccacgcagcagccaactgagagaaagaagg
aggcgacaccacatgtcagtgtgggagcagcgtaccagtcagctccgcaggcacatgcag
atgtccagccaggaaggaatcaataaggatgaacctccactgctcaaccctcatgccagc
atattcaggagaaaaaagccaggtgaaaatgtagcctcagataagcctgaggaggaacag
ggaggcaaggcagagcagccacaggtggaaggcctggaacagccaaccacaggcaccaac
gtcagtgccagtgaggacaagaggagcccatcccctcgagccaagagagaaagggaccag
tggcatcagaaatcgtgtcatgggaactgtgatccaactgaacaagatggcagtggagga
ggaggttcagggtttgaagacagagcccggctaagacagagccagcggcgcagccggcac
cggagggtgcggactgaggggaaggagccagctggagctctagagagccggtcgaccagc
caagatacaggcctggaggatgccaatcctgcagagggacagcagaagaggaatgaagga
ggaaaggaggagaatttgattcagggggagcaggcaggcgaggaactgaaaagaaccaat
ggaatcccagccaacgaggctgaggtccctggggccaccaaagacaggagtccacctaaa
gtccctcatgagctcaaccaggggaataatgtaagcctgactgagcaggactgcagcagt
ctagataccagtgaccaagccctgctgggcggcctccagatggagatgagcagagccatc
agcaggagtgaaccagacctctcctccatcacagccaacactgagaaagccactgagagc
accaccatcatgatcgatgtccaagactccactgtggtacagattagcaacaagacagat
ggagaagccagccccttgaaggaggcagagacaaaagaggatgaggaggaggcagaaaag
aagaaacggaaaaaggagaaaagctcagagacgggcaaagcaatggtgcctcacagctcc
atgttcatcttcagcacgactaaccctgtgcgaagagcctgccattacattgtgaacctg
cgctactttgagatgtgcatcctcctggtgattgcagctagcagcattgcattggcagct
gaagaccctgtcctgaccaactctgacaggaataaagtgactgtcctgaggtattttgac
tatgttttcactggtgtcttcacctttgagatggttatcaagatgatagatcagggcttg
atcctgcaggatggctcctatttccgagacctctggaacatcctggacttcatcgtggtg
gtgggggctttggtggctttcgccttggcgaatgctttggggaccaacaagggccgggat
atcaaaactattaagtctctccgtgtactgcgagtcttgaggccgctgaaaactattaag
cgattgcccaaactcaaggctgtctttgactgtgttgtgacttccttgaagaatgtcttc
aacatactcattgtttacaagctcttcatgttcatctttgctgtcatcgctgtccagctt
ttcaaggggaaatttttctattgtacagacagctctaaggacacagagaaggactgcata
ggcaattatgtggaccatgagaaaaacaagatggaagtgaagtgtcgtgaatggaagcgc
catgaattccactatgacaatatcatttgggctttacttacactcttcactgtctccact
ggagaggggtggccacaggtgctacagcattccgtggatgtgaccgaggaggaccggggg
cccagccgcagtaaccgcatggagatgtccattttttatgtggtgtattttgtggtcttc
cctttcttctttgtcaacatctttgtggctctcattatcatcacattccaggagcaagga
gacaaaatgatggaggaatgcagtctggagaagaatgagagggcatgcattgactttgcc
atcagtgccaaacctctcactcgctacatgcctcaaaaccgacataccttccagtaccgt
gtctggcactttgtggtctctccttcctttgaatacaccatcatggccatgatagctttg
aatactgtggtgctgatgatgaagtattattctgcaccctatacatacgagctggctttg
aagtacctgaacattgcatttaccatggtgttctccttggaatgtgtcctgaagatcata
gcttttggcttcttgaattatttccgggacacctggaacatctttgacttcatcactgtg
attggcagcatcacagaaattatcttgacagacaccaagttggtaaacaccagcggcttc
aacatgagctttctgaagctgttccgggctgctcgcctcatcaaactgctccgccagggc
tacaccatccgtattctgctgtggacctttgtgcagtctttcaaggcccttccctacgtt
tgtctcttgatagctatgcttttcttcatatacgcaatcattgggatgcaggtttttggg
aatatcaaactagatgaaggaagccacataaaccggcacaacaacttccgcagcttcttg
gcctccctcatgctcctttttaggagtgccacaggtgaggcatggcaagagattatgctt
tcatgcctggaaggcaaaggctgtgaacccgacactacagcgacatctggacagaatgag
aacgagcgctgcggcactgacctggcttatgtttactttgtctccttcatcttcttttgc
tcattcctgatgctcaatctgtttgtggcggtcataatggacaattttgaatacctgact
cgggactcctccatcctggggcctcatcacctagacgaatttgtccggatctgggcggag
tatgacagagccgcatgtggccgcatccattacactgagatgtatgaaatgctgactctc
atgtcaccaccgctaggcctcggcaagagatgtccctccaaagtggcctataagaggctg
gtgctgatgaacatgcccgtggctgaggacatgactgtccatttcacctccaccttgatg
gcattgattcgaacagcgctggacataaaaattgccaaaggtggtgcagactggcagcag
ttggattcagagctgcagaaggagatcctgaccatctggcctcacctatcccagaagatg
ctggacttactagtgcccatgccaaaaacttcggacctgactgttggcaaaatatatgca
gccatgatgatcatggactattacaagcagagcaaagcaaagaagcagaggcagcaactg
gaggaacagaaaaatgcccctatgttccagcgcatggagccctcatctctgcctcaagag
ataatttctaatgccaaagctctgccttacctccagcaagacaccctgtcaggcctgagc
agccggagtgggtttccctccctgagtccactctctcctcaagagatatttcagctggct
tgtatggatccaacacatgggcagtaccaggagcaccaatcactggagccagaggttaga
gagtttaaaagagtgcagccctctaaccgtggcaactatctccccgtggacactcaggaa
cgcgctgtatctgggagggcctcctccatgccacgcctgacagtggatccccaggtggtt
acagacacgagctctatgagacgatcattctccaccatccgggacaaacgtaccaacagc
tcctggctggatgagttctccatggagcgaagtagtgagaacacttacaagtcccgccgg
cgcagttaccactcctcgctacagctgaccgctcgccgcctgaatgcagactcaggccac
cggtctgatacgcatcgttcaggtggcagagaacgagggcgatccaaagaacgcaagcac
ctgctgtccccagacatctcccgctgcaactcagaggagaggagtccccaggcagactgc
gagtctccagaacggcggcgtcaatccagatcacccagcgagggcaggtcgcagacgccc
aacaggcagggcacaggttccttgagtgaaagctccatcccctctatatctgacaccagc
accccaaggagaggtcgccggcagctccctcctgtgccgcccaagccacggcctttcatc
tcgtacacttccatgatgcagcatgctggtgacacctccccacaacccgacgagagcgag
ggtgggtcccctctgctttccaaggctctggagacgaatgacacctgcctgaccgagtct
tccagctctccgcagggaaagcagagccggcactccaccccacagcgctacatttcagag
ccctacctggccctgcacgatgactcccacgcctcagactgcggcgaggaggagacactc
accttcgaggctgctgtcgccaccagccttggccgctccaacacaattggctcagcccct
ccgatgaggcacagctggcagatgcccaatgggcattaccggaggaggaggagaggggcg
gcacagggggtgatgtgtggggctagcattgatgtgctaagtgatacggaggaagatgac
aagtgctag

DBGET integrated database retrieval system