KEGG   Alligator mississippiensis (American alligator): 102562165Help
Entry
102562165         CDS       T03087                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00250  Alanine, aspartate and glutamate metabolism
amj00410  beta-Alanine metabolism
amj00430  Taurine and hypotaurine metabolism
amj00650  Butanoate metabolism
amj01100  Metabolic pathways
Module
amj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102562165 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102562165 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102562165 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102562165 (GAD1)
Enzymes [BR:amj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102562165 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102562165
NCBI-ProteinID: XP_006265356
UniProt: A0A151M030
LinkDB All DBs
Position
Un
AA seq 590 aa AA seqDB search
MASSAPSSSTATQDPTPTNLRPTTYDTWCGVAHGCTRKIGLKICGFLQRNNSLEDKSRIV
SSLKERQSSKNLLACENSEKESRFRRTETDFSNLYARDLLPAKNGEEQTVQFLLEVLDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGSALGFG
TDNVILIKCNERGKIIPADLEAKILEAKEKGYVPLYVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERVNSVTWNPHKMMGVLLQCSAILIREKGIL
QGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELSEYLYTKIKNREEFEMVFDGEPEHTNVCFWYIPPSLRGMPDCEERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVVSNPAATKSDIDFLIEEIERLGQDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctcagctccatcctcctctaccgccactcaggaccccaccccaactaattta
cgacccacaacctacgacacgtggtgcggggtggcccatggctgcaccaggaaaatcggg
ctcaagatctgtgggttcttgcaacggaacaacagcctggaggacaagagccggatcgtg
agctccctgaaggaaaggcagtcctccaagaacctgctggcctgcgagaacagcgagaag
gaatccaggttcaggcggaccgagacggacttctccaacctgtacgccagagacctcctg
cccgccaagaatggcgaggagcagaccgtgcagttcctgctggaggtgctggacatcctc
ctcaactacgtgcgcaagaccttcgaccgctccaccaaggtgctggacttccaccacccg
caccagctgctggagggcatggagggcttcaacctggagctgtccgacaaccccgagtcg
ctggagcagatcctggtggactgcagggacaccctgaagtacggggtgcgcacaggtcat
cctcggtttttcaaccagctttccactgggctggatattattggtttggctggcgaatgg
ctgacgtcaactgctaatacaaacatgtttacatatgaaattgcacctgtttttgtcctc
atggagcagataacacttcggaagatgagagagattattggatggtcaaataaggatggt
gatggaatattctcacctgggggggctatatccaatatgtacagcatcatggctgctcgt
tacaagtatttccctgaagtcaaaacaaaaggaatggctgctgttcctaaactggtcctc
tttacttcagaacatagtcactactcaataaagaaagctgggtctgcacttgggtttgga
acagacaatgtgattttgataaaatgtaatgaaagagggaaaataataccagctgatttg
gaagcaaaaattctggaagctaaggaaaagggatatgttccactgtatgttaatgcaact
gcaggcacaacagtatatggagcctttgatccaatacaggagattgcagatatatgtgaa
aaatataacctctggctccatgtggatgctgcttggggaggtggactcctaatgtccagg
aagcatcgccataaactgaatggaatagaaagagtcaactcagtcacatggaatccacac
aagatgatgggagtcttgttgcaatgctctgccattcttattcgggaaaagggtatactt
caaggttgcaatcagatgtgtgcaggatatctgtttcagcaagacaagcagtatgatata
tcctatgacactggagataaggcaatacaatgtggtcgtcatgtggacattttcaaattc
tggttgatgtggaaggcaaagggtacagtaggatttgaaaatcagatcaacaaatgtctg
gaattgtcagagtacctctatactaaaattaaaaacagggaagaatttgagatggttttt
gatggagagcctgaacacacaaatgtatgtttctggtacattccaccaagtctcaggggc
atgccagattgtgaagagagaagagaaaagctacacagggtggcaccgaaaatcaaagca
ctgatgatggagtcaggtacaacaatggttggatatcagcctcagggagataaagtcaac
ttcttccgaatggttgtctcaaacccggcagcaactaagtccgacattgacttcctcatt
gaggaaatagaaagattggggcaggatctgtag

DBGET integrated database retrieval system