KEGG   Alligator mississippiensis (American alligator): 102562876Help
Entry
102562876         CDS       T03087                                 

Gene name
BTK
Definition
(RefSeq) Bruton tyrosine kinase
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102562876 (BTK)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102562876 (BTK)
Protein kinases [BR:amj01001]
 Non-receptor tyrosine kinases
  TEC family
   102562876 (BTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 SH3_3 SH3_10 Kinase-like Haspin_kinase Kdo Pkinase_fungal APH hSH3
Motif
Other DBs
NCBI-GeneID: 102562876
NCBI-ProteinID: XP_019343529
LinkDB All DBs
Position
Un
AA seq 803 aa AA seqDB search
MILAITQWLHLKRQASKCSTEDEAEGNMAAILESIFLKRSQQKKKTSPLNFKKRLFLLTE
SKLSYYEYDFERGRRGSKKGSVDIEKITCVETVVPENNPPPERQIPRKGEDSNEMEQISI
IERFPYPFQVVYDEGPLYIFSPTEELRKRWIHQLKSVIRYNSDLVQKYHPCFWIDGQYLC
CSQTAKNAMGCQVLESRNGSLKTGRSHRKTKKPLPPTPEEDQMMMKPLPPEPAPSMPGEM
KKVVALYDYVPMNAQDLQLQKGEEYFILEESDIPWWRARDRNGKEGYIPSNYVTETRDSL
EMFEWYSKNITRSQAEQLLKQEGKEGGFIVRDSTSKTGKYTVSVYTKSSGDLQGTIRHYV
VCSTPQNQYYLAEKHLFNTIPELITYHQHNSAGLISRLKYPVSQYRKNAPSTAGLGYGSW
EVDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIDEAKVMMDLSHE
KLVQLYGVCTKQRPIFIITEYMANGCLLTYLRESRQRFQPSELLEMCKDICEAMEYLESK
QFLHRDLAARNCLVNDQGIVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFS
SKSDVWSFGVLMWEVYSLGKMPYERFNNTETTEHVIQGLRLYRPQLASERVYAIMYSCWH
EVGFLPALCVPGTGAYCRTPPSRSAQPLAPLLLGLGLPLGPTSTATTARAGDRHLPPQRA
LLETPCRDAHSCVPDVVAPPFVAESRGAPNLPCPLGKHPGPQGRGALRHCPRTSATARQT
LELLEGAKKEPRRSLGRLCQELP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgattctggccattactcagtggctgcacctcaagcggcaggccagcaagtgcagcaca
gaggacgaggcagagggcaacatggcagctattctggagagtatcttcctgaaacgttca
caacagaagaagaaaacgtctcctctcaacttcaagaagcgcctcttcctcctgacagaa
agcaagctctcctactacgagtacgacttcgagcgtggacggcgaggcagtaagaagggg
tcagtggacattgagaaaatcacctgtgtggagacggtggttccagagaacaacccaccc
ccggagcggcagatcccgagaaagggagaagattccaatgagatggagcagatctcgatc
atagagaggttcccatatcccttccaggtggtgtatgatgaaggacccctctatatcttc
tcaccaacagaggagttacgcaagcgctggatccaccagctgaagagtgtgatccgctac
aacagcgacctggtacaaaagtaccacccctgcttctggattgatggacaatacctgtgc
tgctctcagacggccaagaatgccatgggctgccaggtcctggagagcaggaatggaagt
ttaaaaactggacggtctcatcgcaagacaaagaagcctcttcctccaacgcccgaggag
gatcagatgatgatgaagccactaccccctgagccagctcccagcatgccaggtgaaatg
aagaaggttgtggcactttatgactatgtgccaatgaatgcacaggacttgcagctgcag
aagggggaagagtacttcattctggaagaaagcgatataccttggtggagagcccgggat
aggaatgggaaagaaggttacatccctagcaattatgtcacagagaccagggactctctg
gaaatgtttgagtggtactcgaaaaacataacccggagccaagcagagcaactgctgaag
caagaggggaaagaaggaggtttcatagtgcgagattccaccagcaagacaggaaaatac
acagtttcagtatataccaagtcctctggggacctgcagggaacaatccgccattacgtg
gtatgctccacaccccagaaccagtattacctggcagaaaagcacctcttcaacaccatt
ccggagctcatcacataccatcagcacaactctgccgggcttatatccagactgaaatac
ccagtgtctcaataccgaaaaaatgctccttccacagctggactgggctatgggtcatgg
gaggttgatccaaaggatctgacttttctgaaagagctggggactgggcaatttggagtg
gtaaagtatgggaaatggagaggccaatacgatgtggccatcaagatgatccgagaagga
tccatgtcagaggatgagtttattgatgaagccaaagttatgatggacttgtctcacgag
aagctggtgcagctgtatggggtctgtaccaagcaacgacccatctttatcatcacagaa
tacatggccaacggctgcctcttgacctacttgcgggaaagcagacagaggttccagccc
tctgagttgctggagatgtgcaaggacatctgtgaggccatggagtatctggagtccaag
cagttcctgcaccgagatctggctgctcgcaactgtttggtgaatgaccaggggattgtg
aaagtctctgattttggcctttccaggtatgtcctagatgatgagtatacaagctcagtg
gggtccaagtttccagtgcggtggtccccccctgaagtcctgatgtacagcaagttcagc
agcaagtccgatgtctggtcttttggcgttctgatgtgggaggtttactccctggggaag
atgccgtatgagaggttcaacaacactgagacaacggaacacgtcatccaggggctgcgc
ctctatcggcctcagctggcctcggaaagggtctatgccatcatgtacagctgctggcat
gaggtaggcttcctcccagcactgtgcgtcccagggactggtgcctattgcaggacgcct
ccctcacgctctgcccaacctctagcaccactgctgcttgggctcggtctgcctttaggt
cccacctcaactgccacaacagcgagggctggggacaggcatctgccaccgcagcgagca
ctgctagagactccgtgtagggacgctcactcatgcgtgcctgatgtggtggctcctcct
ttcgttgcagaaagcagaggagcgcccaaccttccgtgtcctcttgggaaacatcctgga
cctcagggacgaggagccctgagacactgccctcgcacctctgccaccgcccgacagacg
ctggagcttctcgaaggggccaagaaggagccgcggcgctcgctgggacgcctttgccag
gagcttccttag

DBGET integrated database retrieval system