KEGG   Alligator mississippiensis (American alligator): 102563714
Entry
102563714         CDS       T03087                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04068  FoxO signaling pathway
amj04110  Cell cycle
amj04115  p53 signaling pathway
amj04218  Cellular senescence
amj04310  Wnt signaling pathway
amj04340  Hedgehog signaling pathway
amj04371  Apelin signaling pathway
amj04510  Focal adhesion
amj04530  Tight junction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102563714 (CCND1)
   04340 Hedgehog signaling pathway
    102563714 (CCND1)
   04371 Apelin signaling pathway
    102563714 (CCND1)
   04068 FoxO signaling pathway
    102563714 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102563714 (CCND1)
   04115 p53 signaling pathway
    102563714 (CCND1)
   04218 Cellular senescence
    102563714 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102563714 (CCND1)
   04530 Tight junction
    102563714 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102563714
NCBI-ProteinID: XP_006260138
UniProt: A0A151MBJ5
LinkDB
Position
Un
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLLAMLKAEETCTPSGFYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAVTPHDFIEHFLTKMPLTEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggaaaccatccgaagagcctacctagacgcc
aacctactgaatgacagggtcctgctggccatgctgaaggcggaggagacctgcacgccc
tcgggcttctacttcaagtgcgtgcaaaaggagatcttgccctacatgcggaaaatagtg
gccacttggatgctggaggtttgtgaggagcagaaatgcgaagaggaggtgttccccttg
gctatgaattacttggacaggtttttgtccttcgagcccctcaagaagagccggttgcag
ctgctgggagcgacctgcatgttcgtggcttcgaaaatgaaggaaaccatcccgctgacg
gcagagaagctgtgcatttacaccgacaactccatcaggcccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcagtgacccctcacgatttc
attgaacatttccttactaaaatgcctctgactgaggacaccaagcagatcatccgtaaa
catgcccagacttttgtggctctgtgtgctacagatgttaagtttatttcaaacccaccc
tccatgatcgcagctggcagcgtggtagcagctgtgcaaggccttcacctgggaaacact
aacactttcctttcctatcagtgcctcacacacttcctatcacaagttatcaaatgtgac
ccggactgtttacgagcctgccaagaacagattgaatccctcctcgaatccagtctacgc
caggcacagcaacacaacatatcttcagaaacaaagactgttgaggatgaggcagatctt
tcctgcacgccaactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system