KEGG   Alligator mississippiensis (American alligator): 102566462Help
Entry
102566462         CDS       T03087                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00010  Glycolysis / Gluconeogenesis
amj00030  Pentose phosphate pathway
amj00051  Fructose and mannose metabolism
amj00052  Galactose metabolism
amj01100  Metabolic pathways
amj01200  Carbon metabolism
amj01230  Biosynthesis of amino acids
amj03018  RNA degradation
Module
amj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102566462 (PFKP)
   00030 Pentose phosphate pathway
    102566462 (PFKP)
   00051 Fructose and mannose metabolism
    102566462 (PFKP)
   00052 Galactose metabolism
    102566462 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102566462 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amj01009]
    102566462 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amj03019]
    102566462 (PFKP)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102566462 (PFKP)
Protein phosphatases and associated proteins [BR:amj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102566462 (PFKP)
Messenger RNA biogenesis [BR:amj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102566462 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102566462
NCBI-ProteinID: XP_006268197
LinkDB All DBs
Position
Un
AA seq 789 aa AA seqDB search
MEPHPADKKLFENLSGSGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVEAKVYFVYEGYQG
MVDGGDNIVEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVKRGITNLCVIG
GDGSLTGANLFREEWSGLLEELAESGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEYPPEE
GWEDKMCVKLSENRARKKRLNIIIVAEGAIDSHNKAITSEQVKDLVVRCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQE
VQKAMDEARFKEAVQLRGRSFENNLKTYKLLSHRKQDAELPKSNFNVAVLNVGAPAAGMN
AAVRSAVRVGITEGHKMFAINDGFEGFAKGQIKTVSWGDVGGWTGQGGSILGTKRTLPAK
YLEKIADQMRTYNINALMVIGGFEAYESCLQLYEARSRFEEFCIPICVLPATISNNVPGT
DFSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIF
EEKFDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKISAKAIQWISKKLVETYRKEEGKVFANTDDTVCLLGMR
RRNLVFQPVAELKGETDFVHRIAKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHR
PKEAETGAI
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcacccggccgacaagaagctgttcgagaacctgtcggggtcgggcaaggcc
atcggggtgctgaccagcggcggcgatgcgcaaggtatgaatgcagcagtacgtgcagta
gtgcgcatgggaatctatgtagaagccaaagtgtattttgtgtatgagggttaccagggt
atggttgatggaggtgacaacattgttgaagtctcatgggaaagcgtatcaagtatcctg
caagtgggtggaacggttattgggagtgcacgctgcaaggcatttcgtacccgggaaggt
cgtttgcaagctgcttacaatcttgttaaacgtggaatcactaacctctgtgtgattggt
ggggatggaagcttaacaggtgctaatcttttccgtgaagaatggagtggacttttagag
gaactggcagaaagtggcaagattgacgaagaggcagttaagaaatatgcttacctcaac
attgtgggtatggttgggtccattgataatgatttctgtggtactgatatgaccatagga
actgactcagccttgcacagaatcattgaagttgtggatgcaattatgaccactgcccaa
agccatcagaggacctttgttctggaggttatgggaagacactgtgggtatctagccctt
gtgagtgccttagcttgtggtgcagattgggtactcattcctgagtaccctccagaagaa
ggatgggaggataagatgtgtgttaagctgtctgagaaccgtgcacgaaagaaaaggctg
aatattatcattgtagcagaaggtgccattgattctcacaacaaagccataacatcagag
caagttaaagatcttgtggttcggtgcctgggatttgacactcgtgtgactatactgggt
catgttcagagaggtggtacaccatcagcttttgatagaattttggcaagccgtatgggt
gtggaagccgtccttgccctgcttgaagctacaccagatactcctgcttgtgttgtgtcc
ctgtctggaaaccaggctgtacgtctgcctttaatggagtgcgtgcagatgactcaagaa
gtacagaaggcaatggatgaagcaaggtttaaggaggctgtgcagcttcgaggaaggagt
tttgaaaataaccttaaaacctacaaattattgtctcatagaaaacaagatgcagagctt
ccaaagagtaattttaatgtggcagttttaaatgtaggtgcccctgcagctgggatgaat
gctgctgtgaggtctgcagtgagagttggcataactgaaggacacaaaatgtttgctatc
aatgacggatttgaaggttttgctaaggggcagataaagacagtcagctggggagatgtt
ggaggctggactggccaggggggatcaattctcggcacaaaacgaacccttcctgcaaag
tatttggagaagattgctgaccagatgcgcacttataatatcaatgcccttatggttatt
ggtggatttgaggcctatgaaagttgtctgcaattatatgaggcgcgttcccgctttgag
gagttttgcatacctatctgtgtattgcctgctactattagcaacaatgtaccaggcaca
gactttagcattggtgctgacactgccttgaatgctattgtagagacatgtgatcgcatc
aaacagtcagccagtgggaccaaacgtcgtgtgttcatcattgagaccatgggtggttac
tgcggttacctggccaatatggggggccttgctgcaggtgctgatgctgcttatatcttt
gaagagaagtttgatattcgagaactccaggctaatgtggaacatttgacggaaaagatg
aaaaccagcatccagcgtggtctagtgctgaggaatgaaaactgcaatgagaattacaca
actgatttcatctatcagctgtattctgaggaaggaaaaggtgtgtttgactgcagaaag
aatgtattgggtcacatgcaacaaggtggtgccccttctccgtttgacagaaactttggg
acgaaaatttctgcaaaagccattcagtggatctctaagaaacttgtggaaacataccgg
aaagaagaaggaaaagtatttgccaacactgatgacactgtttgtctgctgggaatgcgc
cggcgcaatcttgttttccaacctgtggctgagcttaagggtgaaacagactttgtgcac
agaattgctaaggaacaatggtggctgaaactccggcccctgatgaaaattctggccaaa
tacaagactagctacgacgtctccgattcagggcagctggagcatgtagcaatgcataga
ccgaaagaagcagaaactggggccatctaa

DBGET integrated database retrieval system