KEGG   Alligator mississippiensis (American alligator): 102566746
Entry
102566746         CDS       T03087                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00230  Purine metabolism
amj01100  Metabolic pathways
amj04020  Calcium signaling pathway
amj04114  Oocyte meiosis
amj04261  Adrenergic signaling in cardiomyocytes
amj04270  Vascular smooth muscle contraction
amj04371  Apelin signaling pathway
amj04540  Gap junction
amj04912  GnRH signaling pathway
amj04914  Progesterone-mediated oocyte maturation
amj04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102566746 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102566746 (ADCY3)
   04020 Calcium signaling pathway
    102566746 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102566746 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102566746 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102566746 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102566746 (ADCY3)
   04916 Melanogenesis
    102566746 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102566746 (ADCY3)
   04270 Vascular smooth muscle contraction
    102566746 (ADCY3)
Enzymes [BR:amj01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102566746 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 102566746
NCBI-ProteinID: XP_006258915
UniProt: A0A151P1B5
LinkDB
Position
Un
AA seq 1124 aa
MPRNRAFSEPEYSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVVYSPDKLAPTLVASVGLALQVL
LFVLCRYRLLPDRVSRKFMPYVLWLLIVAQIFCYLGLNFARFHEASDTVGWQAFFVFSFF
ITLPLSLTPIVLISAVACGIHTLVLGVTIAQQLQDSLNGGALLRQILSNVAIYLCTITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDAS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTNVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQNTMDCLKGEFEVEPGDGGSRCD
YLKEKGIVTYLVLVPKQPLKNGINGVKLSLTSSHGNSPLLINTKECNGSINTTCTTPDEG
EEIDARGNGAEEEGEVVNPSFPNPRRRLRLRDLAERVIDASENEQELNKLLNEALLERES
VQALKGKNTYRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEILIDPWLVA
NYVTFVIGEILLLILTICSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMA
DIVDMLSCLQYYTGPSNVTVTTLLAGGCVENPKYYTYIAVLALIATIMLVQVSHMVKLTL
MVMITGAVGVVNIYAWAQIFDEYDQHRFKDYVSSQLPSKYSMTVMVFIMMLSFYYFSRHV
EKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPDHVARHFLGSKKRDEELYSQSYD
EIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTIGST
YMAASGVTPDANSNGYNTTKKENLSDKERWQHLADLADFALAMKVTLMNINYQSFNNFML
RIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHVILKEYGFRF
VRRGTIFVKGKGELLTFFLKGREKQGSFINGSSITLPHQVVDSS
NT seq 3375 nt   +upstreamnt  +downstreamnt
atgcccaggaacagggccttctccgagcccgagtactcggcagagtactcggcggactac
tcggtcagcctgccctccgaccccgagcacggggtgggccggacccacgaggtgacggtg
aggagctcgggctcgtgcctgtgcctgccgcgcttcatgcgcctcaccttcgcccccgag
tccctggagaacctctaccagacctacttccgccggcagcgccacgagaccctcctggtg
ctggtggtcttcgcggccctcttcgactgctacgtcatcgtcatgtgcgccgtggtctac
tccccggacaagctggcccccacgctcgtggcctcggtgggcctggctctgcaggtcttg
ctcttcgtcctctgcaggtaccggctcttgccggaccgcgtctcccgcaagttcatgccc
tacgtcctctggctcctcatcgtggcccagatcttctgctacctgggcctcaacttcgcc
cgcttccacgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcaccttgcccctcagcctcacgcccatcgtcctcatcagcgccgtggcctgcggcatc
cacaccctggtgctcggggtcaccatcgcccagcagctgcaggactccctcaacggaggg
gccttgctccggcagatcctgtccaatgtcgccatctacctgtgcaccatcaccgtgggc
atcatgtcctactacatggccgaccgcaagcaccgcaaagcctttctggaagcacggcag
tccttggaggtcaagctgaacctggaggagcagagccagcagcaggaacggttgatgctt
tccatcctgcccaagcacgttgcggacgagatgctaaaggacatgaagaaggacgcgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctgttcgctgacatcgtcggcttcacccagctgtcctcgtcctgcagcgcccaggagctg
gtgaagctgctgaacgagctctttgcccgctttgacaagctggccgcgaaataccaccag
ctgcgcatcaagatcctgggagactgctactactgcatctgcgggctgcccgactaccgg
gaagaccacgccgtctgctccatcctgatgggactggccatggtggaagccatctcctac
gtacgagagaagaccaaaaccaacgtggacatgcgtgtgggggtccacaccggcacggtg
ctgggcggggtgctgggccagaagcgctggcagtacgacgtgtggtcgacagacgtaacg
gtggcaaacaagatggaggctggcggcatccctgggcgagtgcacatctcccagaatacc
atggactgcttgaagggcgagttcgaagtggagccgggagacggcgggtcgaggtgtgac
tacctgaaggagaaggggattgtcacgtacctggtcttggtgcccaagcagcccctcaag
aacgggatcaatggcgtgaagctgtccctgacgtcgtcgcatgggaactcgccgctgctg
atcaacaccaaggagtgcaacggcagcatcaacaccacgtgcaccacgcctgacgagggc
gaggagatagatgcccgcgggaacggggcggaggaagagggcgaggtggtgaacccatcc
ttccccaacccgcggcggcgcctgcggctgcgcgacctggccgagagggtcatcgacgcc
tcggagaacgagcaggagctcaacaagctgctcaacgaggctctgctggagagggagtcc
gtccaggcgttgaaggggaagaacacgtaccgcctgtccatgcgtttcatcgaccccgag
atggagacacgctactccgtggagaaggagaagcagagcggggccgccttcagctgctcc
tgtgtcgtcctcttcttcactgccctggtggagatcctcatcgacccctggctggtggcc
aattacgtgacattcgttatcggggagatcttgctgctgatcctgaccatctgctctctg
gctgccatcttccccagggtgttccccaaaaagctcgtggccttttccacgtggatcgac
aggacccgctgggcccggaacacgtgggccatgtccgccatcttcatcctcaccatggcc
gacattgtggatatgctcagctgcttgcagtactacactggtcccagcaatgtcacggtg
acgaccctgctggcgggcggctgcgtggagaaccccaagtactacacctacatcgccgtg
ctggccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctgaccctg
atggtcatgatcaccggcgctgtgggcgttgtcaacatctatgcctgggcacagatcttc
gacgagtatgaccagcaccgcttcaaggactatgtgtcctcacagcttccctccaagtac
tccatgacagtgatggtcttcatcatgatgctcagcttttactatttctctcgccatgtg
gagaagctggccaggaccctgttcctgtggaagatcgacgtgcacgaccagaaggagcgg
gtgtacgagatgcggcgctggaacgaggcgctggtcaccaacatgctgccggaccatgtg
gccaggcacttcctgggctccaagaagcgggatgaggagctgtacagccagtcctacgac
gagatcggcgtcatgttcgcctccctgcccaacttcgctgacttctacacggaggagagc
atcaacaacggcggcatcgagtgcctgcgcttcctcaacgagatcatctccgacttcgac
gcgctcctggatgagccccagttccgatgcatcaccaagatcaaaaccatcggcagcacc
tacatggcggcctccggagtgacccctgatgccaacagcaatggctacaacaccaccaag
aaggagaacctgtcagacaaggagcgctggcagcaccttgccgacctggcggactttgcc
ttggccatgaaagtgaccctgatgaacatcaactaccagtctttcaacaacttcatgctc
cgcataggcatgaacaaaggggcggtgctggcaggcgtgatcggcgcgcgcaagccccac
tatgacatctggggcaacacagtgaatgtcgccagcaggatggagtcaacgggcgtcatg
ggaaacatacaggtggtggaggagacccacgtcatcctcaaggagtacggcttccgcttc
gtgcgccgcggcaccatcttcgtcaagggcaagggggagctgctgaccttcttcctcaag
ggccgcgagaagcagggctccttcatcaacggctcctccatcacgctgccccaccaggtg
gtcgacagctcctga

DBGET integrated database retrieval system