KEGG   Alligator mississippiensis (American alligator): 102567247Help
Entry
102567247         CDS       T03087                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102567247 (TMPRSS2)
Peptidases [BR:amj01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102567247 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Ldl_recept_a SRCR Trypsin_2
Motif
Other DBs
NCBI-GeneID: 102567247
NCBI-ProteinID: XP_006274646
LinkDB All DBs
Position
Un
AA seq 489 aa AA seqDB search
MASNSGLPPYYENHGYEPERSYNSRHVIDTSGYPQYIPTSHPASVPHYVPSVPPQHPATV
VVQPKPSSEKLCTSGVKKTLCIVLAVAVILTGAVVAALLIWYFVQDPCFDSSIECGSSGE
CVPLSQWCDGRFDCPNGEDENRCVRLYGPNFILEVYSSENKSWYPVCADDWNDDYGKTAC
KDMGYNVNTYYSSGRIAIEKGAKSFLRLNTSAGNIDLYKKLYNSDSCALGTVVSLRCIMC
GYSSNNLMPKGRIVGGSAASLGQWPWQVSLHIQNTHVCGGSLITPEWVVTAAHCVEGQLA
DPSYWKVFAGILTQDEMRLRSGHRVQKIIPHPNYNTETKDNDVALMKLQTSVSFTNFVAP
ICLPNPGMMFQPNQSCWISGWGALQQGGKTSNFLNAVMVPLIEPSRCNAGLVYNGLILPT
MICAGYLEGLIDSCQGDSGGPLVTAKDSVWWLVGDTSWGTGCATRNRPGVYGNMTMFTAW
IYRNMQANR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaactcagggctaccaccatactatgaaaatcacggctatgagccagaaagg
tcctataattctaggcacgttatagacactagcggctatccacagtacattcctacaagc
catcctgcatcagtgccacattatgttccaagtgttcctcctcaacatccagctacagtg
gtagtacagccaaagccttcgtctgagaaactgtgcacatcaggtgttaagaaaacctta
tgcattgtcttagctgttgcagtaatcctcacaggtgcagtagttgcagcactccttatc
tggtattttgtgcaggatccgtgttttgattcttcaatagaatgtgggtcttcaggagaa
tgtgtgccattatcccagtggtgtgacggacgctttgactgtcctaatggtgaagatgaa
aaccgatgtgttaggctttatggacccaattttattctggaggtctactcatcagagaac
aaatcctggtatcctgtatgtgcagatgactggaatgatgattatggaaagacagcatgt
aaagacatggggtataatgtaaatacttattactctagtgggagaatagcaattgagaaa
ggagctaaaagctttctgagactgaacacaagtgctgggaatatagacttgtacaagaaa
ttgtataacagtgattcctgtgcattgggaacagtggtttctctgcgctgcataatgtgt
ggttattccagtaacaacctgatgcctaaaggcagaattgtgggtggaagtgccgcatca
cttgggcagtggccatggcaggtcagccttcatatccagaacactcatgtatgtggaggc
tccctcatcacccccgaatgggtagtgacagcagcacactgtgtggaaggacagcttgca
gatccatcttactggaaagtttttgctgggattctaacacaggatgaaatgcgtctgaga
agcggacacagagtacagaaaataattccacatccaaattacaatacagagactaaagac
aatgatgttgcccttatgaagttacagacatcagtgagttttacaaattttgtagcacca
atttgtctgccaaaccctggaatgatgttccagcctaatcagtcatgctggatatctgga
tggggagccctacaacaaggaggtaaaacctcaaattttttgaatgctgtgatggtgcct
ttgatagagccttccaggtgtaatgctgggttagtctataatggcctcattttgcctact
atgatatgcgctggatatctagaaggactaattgattcctgtcagggtgacagtggaggc
cctttagtaacagcgaaggactctgtgtggtggctagttggtgacacaagctggggaact
ggctgtgccactcgcaatagacctggagtttatggaaatatgaccatgtttacggcttgg
atttacagaaacatgcaggcaaacagatga

DBGET integrated database retrieval system