KEGG   Alligator mississippiensis (American alligator): 102567302
Entry
102567302         CDS       T03087                                 

Gene name
CDKN1D
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04012  ErbB signaling pathway
amj04068  FoxO signaling pathway
amj04110  Cell cycle
amj04115  p53 signaling pathway
amj04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102567302 (CDKN1D)
   04068 FoxO signaling pathway
    102567302 (CDKN1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102567302 (CDKN1D)
   04115 p53 signaling pathway
    102567302 (CDKN1D)
   04218 Cellular senescence
    102567302 (CDKN1D)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102567302
NCBI-ProteinID: XP_006267961
LinkDB
Position
Un
AA seq 170 aa
MESLIFKLTGEQQKGEKMMVWRPVKTNCVRRNLFGPVDHEQLQKDFQQLLRSGVEGAKQK
WNFDFLREIPAEGLLQWEELQGHEVPAFYHSCVVGEARKPLQLLNRPMGKEARDHQFAKV
TMTEKSKAPKKIVGKSQEVRKQRQASVTDYYSAKKRVKTNTKAASENVAF
NT seq 513 nt   +upstreamnt  +downstreamnt
atggaatcactgatctttaagctcactggagagcagcagaagggcgaaaagatgatggtg
tggagaccagtgaagacaaactgtgtgcgaaggaacctctttggtcctgtggaccatgag
cagctgcagaaggacttccagcagctactgcgcagcggtgtagagggagccaagcagaag
tggaactttgacttcctacgagaaataccagctgaggggctcctgcaatgggaagagcta
cagggccatgaggtcccagccttttaccacagctgtgtggtaggagaggctcgcaagccc
ttgcagctcttgaaccggcccatgggtaaggaagccagggatcaccagtttgccaaggtg
acaatgactgagaaatccaaagctcccaagaaaattgtaggcaagagccaagaagtgagg
aaacaaagacaggcttccgtcacagattactactcagcgaagaagagagtcaaaactaac
acaaaagctgcttcagaaaatgtggctttctga

DBGET integrated database retrieval system