KEGG   Alligator mississippiensis (American alligator): 102568076
Entry
102568076         CDS       T03087                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102568076 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102568076 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amj04052]
    102568076 (KITLG)
Cytokines and growth factors [BR:amj04052]
 Growth factors
  Growth factors (RTK binding)
   102568076 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102568076
NCBI-ProteinID: XP_019336461
UniProt: A0A151LYN8
LinkDB
Position
Un
AA seq 277 aa
MKRTQTWIITCFYLQLLLLSPLVRAHSPCGNPVTDDVNDITILVGNLPNDYRITLKYVEK
MESLPNHCWLYLMVPEFSKSLNNLLHKFSQISDVLSNHSIINNLTRIIYDLMECLALDKN
KNFKQESDHLYKEGKFIPEEFFRHFNNIIEAYKTFSETSDYDDCVLPSTETPVHDSKVTE
TKPFSLPPVAASSLKNNNDSSVQDTLGYTSSSSLQGISIALPSLFSLLIGLALGAVCWKK
THPKSKPESEETERGSDCREENEISMLQQKEKELLQV
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaagaggacacaaacttggattatcacttgcttttatcttcagctgctcctacttagt
ccacttgtcagagctcatagtccctgtgggaatccagtgacagatgatgtgaatgacatt
acaatattggttggaaatcttccaaatgattataggataacccttaaatatgtcgagaag
atggaaagtctgcctaatcactgttggttgtatttgatggtgcctgaattttcaaagagt
ctgaataatctgctccacaaattttcacaaatatctgatgttttaagcaaccattcaatc
atcaataatctcacaaggataatttatgatcttatggaatgtctagcattagataaaaat
aagaattttaaacaagaaagcgatcacctgtataaagaaggcaagttcattcctgaggaa
ttctttaggcattttaacaacatcattgaagcctataagacgttttcagaaacatcagat
tatgatgactgtgttctgccttcaacagaaacaccagttcatgattccaaggtcactgaa
acaaagccattttcattacctcctgttgctgccagttcccttaagaataacaatgatagc
agtgtccaggatacacttggctacactagcagctctagcctgcaagggataagcatagca
ttgccatcattgttttctcttcttattggccttgctttgggagcagtatgctggaagaaa
acacatcccaaatctaaaccagaaagtgaagaaactgaacggggtagtgactgtcgagaa
gaaaatgagataagtatgttgcagcaaaaagaaaaagagcttttacaagtgtag

DBGET integrated database retrieval system