KEGG   Alligator mississippiensis (American alligator): 102568103Help
Entry
102568103         CDS       T03087                                 

Definition
(RefSeq) anionic trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102568103
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amj01002]
    102568103
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amj04147]
    102568103
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102568103
Peptidases [BR:amj01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102568103
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102568103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 102568103
NCBI-ProteinID: XP_006271853
UniProt: A0A151NL27
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MQFLLILACLGAAVAFPVDDDDKIVGGYTCPENAVRYQVSLNSGYHFCGGSLISDLWVVS
AAHCYKSRMEVRLGEFNIEKLEGTEEFIGVEKAIRHPKYNSWLLDNDIMLIKLKTPAKLT
QSVNTIPLPTACVAAGTECLISGWGNTLSDGYNLPELLQCLNAPVLTHAECEASYPGDIT
ENMICVGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGIGCALPGYPGVYTKVCNYLAWIE
ETVASN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcctcctgattcttgcctgcttgggagcagctgttgctttccctgttgacgat
gatgacaagattgtggggggctacacctgcccagagaatgctgtccgctaccaggtgtcc
ttaaactctgggtaccacttctgtgggggctccctcatcagtgacctatgggtagtgtcg
gctgctcactgctacaaatcccgtatggaggtaaggcttggtgagttcaacattgagaag
ctggaagggactgaagagttcattggagttgaaaaagccatccgccatcctaaatacaac
tcctggctcctggacaatgacatcatgctgatcaagctgaaaaccccagccaagctgacg
caaagtgttaataccattcctctgcccactgcctgtgtggctgctgggactgaatgcctg
atttctgggtggggaaacaccctcagtgatggctataacttacctgagctccttcagtgc
ctgaatgctccagtcctgactcatgctgagtgtgaggcatcttatccaggagatatcact
gagaacatgatctgcgtgggatttctggagggcggcaaggactcctgccagggtgattct
ggtggcccagttgtgtgcaacggggagctccaaggggtcgtgtcctgggggatcggctgc
gctctgccaggttacccaggcgtctacaccaaggtctgcaactaccttgcctggattgag
gagaccgtggctagtaactga

DBGET integrated database retrieval system