KEGG   Alligator mississippiensis (American alligator): 102568235
Entry
102568235         CDS       T03087                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04012  ErbB signaling pathway
amj04068  FoxO signaling pathway
amj04110  Cell cycle
amj04115  p53 signaling pathway
amj04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102568235 (CDKN1A)
   04068 FoxO signaling pathway
    102568235 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102568235 (CDKN1A)
   04115 p53 signaling pathway
    102568235 (CDKN1A)
   04218 Cellular senescence
    102568235 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102568235
NCBI-ProteinID: XP_014460937
LinkDB
Position
Un
AA seq 151 aa
MPLSQSNLRQTPCSRKSCRNLFGPVDHEQLQSDFQDSMRKNLEEAQLKWNFDFETETPLE
GAFKWERVPFPDMSSEYLCSHSKVPGENSRSTSTLKIPTKDLLNRPFSGETIQQVSEANR
ASSPRRLKRRQTTIKDFYSLKRKISSSKPNP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgcctctgtcacagagcaacctccggcagaccccctgcagcaggaagagctgcagaaac
ctctttggcccagtggatcatgagcagctccagagcgactttcaggactcgatgaggaaa
aacctggaagaagcccagctcaagtggaattttgactttgaaactgaaacgccgctggaa
ggtgccttcaagtgggagagggtcccatttccagacatgtcttctgagtacctctgcagc
cactccaaagtccctggagagaacagtcgaagcacttccaccctcaagattcccacaaaa
gatctccttaatcggcccttctcgggtgaaaccatacaacaggtctctgaggccaatcgg
gccagctctccaaggcgcctgaaacgcagacagaccaccattaaagatttctacagttta
aagcggaagatctcgtccagcaagccaaatccttga

DBGET integrated database retrieval system