KEGG   Alligator mississippiensis (American alligator): 102569051Help
Entry
102569051         CDS       T03087                                 

Gene name
NEU3
Definition
(RefSeq) neuraminidase 3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00511  Other glycan degradation
amj00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102569051 (NEU3)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102569051 (NEU3)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102569051 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 102569051
NCBI-ProteinID: XP_006258017
UniProt: A0A151PIZ7
LinkDB All DBs
Position
Un
AA seq 451 aa AA seqDB search
MPWAPANTRRQTLFWQEAQGGVTYRIPALLYLPRTHTFLAFAEQRCSIRDEDAKCLVLRR
GWKHGASVKWGPIETLTAAMLPNHRTMNPCPVYEEDSGTVFLFFICVRQHVTERHQICTG
RNAARLCNVASRDSGRTWSPLMDLTEQVIGEDLKKWATFAVGPGHGVQLSSGRLVIPAYT
YYIHTRFCGIPVSCFTKPHSLIFYSDDRGQKWHKGKLLKGKSTVECEVAEVRDKDRGPTL
HCNARTPGKCRAIAFSRDRGVVFERPSWCKELCEPPNGCQGSVVSFFPMEEPAVVDGVEG
TGPDVGEKTCLARCKNTSSTTCHGATSWLVYSHPTSRHRRVNLGIYLNKTPLETRSWERP
WVLYQGPCGYSDLAVCEESPPLFGCLFECGVDFPCEQIVFQLFTQQELESHGGSSSSEQQ
PQTKMDVEQMGQYPRQEGSPKALHLGAMGGH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccctgggctccagccaacaccaggagacagacgcttttctggcaggaggcgcagggc
ggggtgacctaccggatcccggcgctgctctacctcccccgcacccacaccttcctggcc
tttgctgagcagcgctgctccatcagggatgaggacgccaaatgcctggtgctgcgaagg
ggctggaagcacggtgcctcggtgaagtggggacccatcgaaaccctgacggcagccatg
ctaccaaaccaccgcaccatgaacccttgcccggtgtacgaggaggacagcgggacggtc
ttcctgttcttcatctgcgtgaggcagcacgtgacagagcggcaccagatctgcaccggg
aggaacgctgctaggctgtgcaacgtcgctagcagggacagcggccggacctggagcccg
ttgatggatctgacagagcaagtgatcggggaggacctgaagaagtgggccacctttgca
gtggggccaggccacggggtgcagctcagctctgggcggctggtgatcccagcttacacc
tactacattcacacccgcttctgcggcattcccgtgtcctgcttcaccaagccccactcc
ttgatcttctacagtgatgaccgcggccaaaagtggcataaaggcaagctcctcaagggc
aagagcacagtggagtgtgaagtggccgaggtgagagacaaagacagaggccccacactg
cactgcaatgcccgcaccccgggcaagtgccgggcgattgcgttcagcagagaccgtggg
gtggtttttgaaagaccttcatggtgtaaggagctgtgcgagccacctaatgggtgccag
ggcagtgtggtgagcttcttcccaatggaagagcctgctgtggtggatggtgtggaaggg
acaggccccgatgtgggtgagaagacttgcttggcacgctgcaagaacacctcttccacc
acctgccatggtgccacctcatggcttgtctactcccaccccaccagcagacacaggagg
gtcaacttgggcatctacctcaacaagactcctttggagacgagaagctgggaaaggcct
tgggtcctctaccaagggccgtgtggttactcggacctggccgtgtgcgaggagtcacca
cctctgttcggctgcttgttcgagtgtggggtggacttcccgtgtgagcagattgtgttt
cagctcttcacccaacaggagctggagagccacgggggctcttcttcctccgagcagcag
ccacagacaaagatggatgttgagcagatggggcagtatcccaggcaggaaggatcacct
aaagctcttcatctcggtgccatgggagggcattga

DBGET integrated database retrieval system