KEGG   Alligator mississippiensis (American alligator): 102569468Help
Entry
102569468         CDS       T03087                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:amj00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102569468 (SOD1)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102569468 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102569468
NCBI-ProteinID: XP_006268211
UniProt: A0A151MDZ9
LinkDB All DBs
Position
Un
AA seq 154 aa AA seqDB search
MAALKAVCVLRGDGPVSGVVNFEQKDSGPVKLSGSIQGLSDGKHGFHVHEFGDNTNGCIS
AGAHFNPYGKKHGGPDDEERHVGDLGNVTAKGGVAEISIVDPHISLTGPNCIIGRTMVVH
DKEDDLGKGENEESTKTGNAGGRLACGVIGIAKM
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgaaggctgtgtgtgtgctgcgcggggacgggcccgtgtccggcgtcgtc
aatttcgagcagaaggatagtggaccagtaaagctgtcaggaagcattcaaggtttgagt
gatggaaaacatggcttccatgttcatgaatttggagacaacactaatggatgcatcagt
gcaggtgctcacttcaatccttatggcaaaaaacatggtggaccagatgatgaagagagg
catgttggagacctcggcaatgtgactgctaagggtggagtggcggagatatccattgta
gatccccacatttcacttactggacccaattgcattattggacgtaccatggtggttcat
gataaggaagatgacttgggtaaaggagaaaatgaagagagcacaaaaactggcaatgct
ggtggtcgcttggcttgtggtgtaattggaatagccaagatgtaa

DBGET integrated database retrieval system