KEGG   Alligator mississippiensis (American alligator): 102569961Help
Entry
102569961         CDS       T03087                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00010  Glycolysis / Gluconeogenesis
amj00051  Fructose and mannose metabolism
amj00052  Galactose metabolism
amj00500  Starch and sucrose metabolism
amj00520  Amino sugar and nucleotide sugar metabolism
amj00524  Neomycin, kanamycin and gentamicin biosynthesis
amj01100  Metabolic pathways
amj01200  Carbon metabolism
amj04910  Insulin signaling pathway
Module
amj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102569961 (HK1)
   00051 Fructose and mannose metabolism
    102569961 (HK1)
   00052 Galactose metabolism
    102569961 (HK1)
   00500 Starch and sucrose metabolism
    102569961 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102569961 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102569961 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102569961 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amj04131]
    102569961 (HK1)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102569961 (HK1)
Membrane trafficking [BR:amj04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102569961 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102569961
NCBI-ProteinID: XP_006273538
UniProt: A0A151P1D6
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMARFRREMKNGLSRDFNPTAT
IKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMETEIYNTPEDIMH
GTGTRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRYKASGV
EGADVVKLLNKAIKKHGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVHHVCTIVSFRSANLVACTLGAILNQLRDNKGVPRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRLIAETLAEFKLT
HEQLLQVKKRMRMEMEAGMKKKTHDSAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPVEVMLGTGEELFDHIVACISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVEGDQGRMCVNMEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRS
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
VVDKIRENRGLEHLEITVGVDGTLYKLHPHFSKVMHQTVKDLAPKCDVTFLLSEDGSGKG
AALITAVGCRLRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggcccagctcctggcctactacttcaccgagctcaaggatgaccaggtcaag
aagattgataaatatctttatgctatgcggctctctgatgaaaccctgctggatattatg
gctcgcttcaggagagagatgaaaaacggtctttctagagacttcaatccaacagctaca
ataaaaatgcttcctacatttgtaagatcgattcctgatggctcagagaaaggagatttc
attgcattggatcttggtggatcttattttcgaattctgcgggtgaaggtctctcatgaa
aaaaagcagacggtacaaatggaaactgaaatttataacacaccagaagatatcatgcat
ggcactggaacaaggctgtttgatcatgttgccgaatgcctgggagacttcatggagaaa
cagaaaatcaaggacaaaaaactaccagttggttttacattttctttcccatgtagacaa
tccaagctggatgagggtattctgataacgtggacaaaacgctacaaagccagtggagtt
gaaggagcagatgttgtaaagctacttaacaaggcaatcaagaaacatggggactatgat
gcagacatcatggctgttgtaaatgatacagtagggacaatgatgacctgtgggtttgat
gatcagcgttgtgaagtaggcttgattataggtactggcaccaatgcttgctacatggaa
gaaatgagacacattgatttggtggaaggtgatgaggggagaatgtgcatcaacaccgag
tggggagcctttggagatgatgggtcactagaagatatccgaactgagtttgatagggag
attgaccgtggttctcttaatcctggaaaacaactatttgagaagatggtgagtggaatg
tacatgggtgaattggtcaggctcatccttgtcaagatggccaaagaaggactgcttttt
gaagggagaatcactccagagcttttaaccaaaggaaaatttgaaacaaagcatgtttct
gccatagaaaaaagcaaagaaggtttgaataaagccaaagaaattttgacacgccttggt
gtagagccatcccatgaagattgcattgctgtccatcatgtttgtacaatcgtttcattt
cgttctgcaaatctggttgcttgtaccttgggtgcaattctgaatcaactacgtgacaat
aaaggagtacccaggctgcgtaccacagtgggggtagatggttccctttacaagatgcat
ccacaatatgcccgacgcttgcacaaaacaacaaggcgcttagttcctgactctgatgtg
cgattcctcctgtctgagagtggcagtggaaagggtgctgcaatggtcacagcagtggct
tacaggttggctgagcagcacaggctgatagctgaaactctggctgaattcaagcttact
cacgaacagctattgcaggttaagaagaggatgcgaatggaaatggaagctggaatgaag
aagaaaactcacgatagtgcaaaagtgaaaatgctgcccacatttgtccgcagcacacca
gatggaacagagaatggagacttcctggctcttgatcttggaggaacaaactttagagtt
ttgcttgtgaagatacgtagtggtaaaaggagaacagttgaaatgcacaataaaatatat
gccatccctgtagaagtcatgctgggtactggtgaagagctgtttgatcacatagttgcc
tgcatctcggacttcctggattacatgggaataaaaggtgcacgccttccccttggattt
acattttccttcccttgcaaacagacaagtttagatgctggtatcctcctcaactggacc
aagggttttaaagctacagactgtgaaggagaagatgttgtatatttgctcagggaagga
attaaacggagagaggaatttgacttggatgttgttgcagtggtcaatgatacagttggc
actatgatgacttgtgcgtatgaagatccaaactgtgagattggacttattgtgggaact
ggcagcaatgcatgttacatggaggaaatgaggaatatagagatggtggaaggagatcaa
ggaagaatgtgtgtgaacatggaatggggtgcgtttggagacaatggatgcctggatgac
atcaggacaatttatgacaaagctgttgatgattattcattaaatgctggaaaacaaagg
tatgagaaaatgattagtggaatgtaccttggagagattgttcgcaatattttgattgat
ttcactaaaaggggattcttgtttagaggtcaaatttcagagacactgaagaccagaagt
atctttgaaaccaagttcctttcacagattgagagtgacaggttagctttgcttcaggta
cgagcaatccttcagcagcttggcctgaacagtacctgtgatgacagtataattgtaaag
acagtgtgtggggcagtatcacgaagagcagctcagttgtgtggagcaggaatggctgct
gttgtagataaaataagggagaacagaggattagaacatctggaaataactgtcggtgta
gatgggactctgtataaactacatccgcacttttcaaaggtaatgcaccaaacagtaaag
gatctggctccaaagtgcgatgtgacgttcctgctttcggaagacggcagtgggaaaggg
gcagctctcattactgctgtgggatgccgacttcgtgatgctgaacaaaactaa

DBGET integrated database retrieval system