KEGG   Alligator mississippiensis (American alligator): 102570160
Entry
102570160         CDS       T03087                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102570160 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102570160 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amj04052]
    102570160 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:amj00536]
    102570160 (FGF1)
Cytokines and growth factors [BR:amj04052]
 Growth factors
  Growth factors (RTK binding)
   102570160 (FGF1)
Glycosaminoglycan binding proteins [BR:amj00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102570160 (FGF1)
SSDB
Motif
Pfam: FGF Fascin CDtoxinA
Other DBs
NCBI-GeneID: 102570160
NCBI-ProteinID: XP_019333959
UniProt: A0A151M6W0
LinkDB
Position
Un
AA seq 155 aa
MAEGKITTFTALTEKFNLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAESVGVVYIKSTKSGQYLAMDTNGLLYGSQLMSEECLFLERMEENHYNTYTSKKNADK
NWFVGLKKNGSTKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaagggaaaataacaactttcaccgccctgacggaaaaattcaaccttcccttg
gggaattacaagaaacccaagctcctgtactgcagcaatggaggccacttcttgaggata
cttccagatggcaaggtagatgggacaagggaccgaagcgaccaacacatccaactgcag
ctaagcgcggaaagcgtgggtgtagtgtatataaagagcaccaagtctggacagtacttg
gctatggacaccaatggccttttatatggatcacagttaatgagtgaggaatgtttgttc
ctggaaaggatggaagaaaatcattacaacacatatacatctaagaagaatgcagataag
aactggttcgttggcttaaagaagaatggaagcaccaaactgggaccacggactcactat
ggccagaaggcaatccttttccttccgctgccagtgtcagctgattag

DBGET integrated database retrieval system