KEGG   Alligator mississippiensis (American alligator): 102570491Help
Entry
102570491         CDS       T03087                                 

Gene name
SLC2A1, SLC2A3
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 3
  KO
K08142  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 3
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amj02000]
    102570491 (SLC2A1)
Transporters [BR:amj02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   102570491 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    102570491 (SLC2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 102570491
NCBI-ProteinID: XP_006267647
LinkDB All DBs
Position
Un
AA seq 538 aa AA seqDB search
MNLRPVASIPGRVCSEDRPSQRSASRRTAEEGQGAGSDRSSTMDRPKITGSLIYAVCIAA
IGSLQFGYNTGVINAPEKIIQEFFNQTLSVRRGTPTSDELLTSLWSLSVAIFSVGGMIGS
FSVGLFVNRFGRRNSMLGVNILALVGGILMGFSRLAGAVEMLIIGRFIIGIFCGLCTGFV
PMYISEVSPTALRGAFGTLNQLGIVVGILVAQIFGLNQIMGTKTLWPLLLGFTIIPAILQ
CVALLFCPESPRFLLINKMEDDKAEAVLQKLRGTVDVSQDIQEMKDESAKMSQEKKVTVP
ELFRSPSYRQAIIVAIVLQLSQQLSGINAVFYYSTGIFEKAGITQPVYATIGAGIVNTVF
TVVSLFLVERAGRRTLHLVGLGGMAVCAAIMTIALALKDIVSWIRYISIVATFGFVALFE
IGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGMLFPYAEKLCGPYVFLIFLVF
LVIFFVFTFFKVPETKGRTFEDISRGFEGRPEEVRPTSPVEKSPMVELNSIQPAKEVF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcagaccagtggcatcaatcccagggcgagtgtgcagcgaagaccgacccagc
cagcgcagcgcatcgcgtaggaccgcggaggagggacagggagcaggctcggatcgctcc
agcaccatggaccgcccgaagataacaggatcccttatctatgctgtttgcattgctgca
attggatcgctccagtttggctacaacactggagtcatcaatgctcctgagaagattatt
caggagttcttcaaccagacgttgtcagttcggagagggacccccacctctgatgagctc
ctcacctcactatggtccctttctgtggccatcttctctgtaggaggaatgatcggctcc
ttctccgttggccttttcgtcaaccgattcggcaggaggaactccatgctgggggtgaac
atcttggccctggtgggaggaatcctcatgggcttctccaggctggcaggtgcagtggag
atgctaatcataggccgcttcatcattggcatcttctgtgggctctgcactggctttgtg
cccatgtatatcagtgaagtctcacccactgccttgcgtggtgcctttggcaccctgaac
cagctgggtattgtggtgggcatcctggtggcacagatctttggcttgaaccagatcatg
gggaccaaaacactctggccactgcttttggggttcaccatcatcccagccatcttgcag
tgtgtggctctgcttttctgcccagagagtccccgtttcctgctgatcaacaaaatggaa
gacgataaagcggaagcagttctccagaagctccgtggcacagtggatgtgagccaagac
atccaagagatgaaggatgagagtgccaagatgtctcaggaaaagaaggtgacagtgcca
gagctcttccggtctccaagctaccgccaggccatcattgttgccattgtgcttcagctc
tcccagcagctctcaggcatcaatgctgtattttattattccaccgggatttttgaaaaa
gctggtatcacccagccagtttatgccaccattggtgccgggattgtgaacacagtcttc
actgttgtatcgctgttcctggttgagcgtgcagggcgcaggaccctccatctagtcggc
ttgggtggcatggctgtttgcgcagccatcatgaccattgctttggcactgaaggacatc
gtgagctggattaggtacatcagcattgtggctacctttggctttgtggctctttttgaa
attggccctggccccatcccctggtttattgtggctgaactcttcagtcagggcccacgc
ccagcagccatggcagtggctggttgctccaactggacctccaatttcctggtggggatg
ctcttcccttatgctgagaaactgtgcggtccttatgtcttcctcatcttccttgttttc
ctggttatcttctttgtcttcacattcttcaaagtcccagagaccaagggcaggactttt
gaagacatctccaggggctttgaagggcggccagaagaagttagacccacatcacctgtg
gaaaaaagccccatggtggaactgaacagcatacagcctgctaaggaagttttctaa

DBGET integrated database retrieval system