KEGG   Alligator mississippiensis (American alligator): 102570675
Entry
102570675         CDS       T03087                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102570675 (TGFA)
   04012 ErbB signaling pathway
    102570675 (TGFA)
SSDB
Motif
Pfam: EGF Adeno_E3_CR2 DUF1180 TMEM154 Collectrin Insulin_TMD UPF0560
Other DBs
NCBI-GeneID: 102570675
NCBI-ProteinID: XP_006276254
UniProt: A0A151P4Y5
LinkDB
Position
Un
AA seq 159 aa
MVSAAGELALIALGFLLPVCHALENTTSALNGPPVAAAVRSHFNECPDSHSQFCFHGTCR
FLVQEDKPACICHSGYVGTRCEHADLLAVVAANQKKQTITALVVVSVVASVVLIVVCVLI
HCCRVRKHCEWCRAFVCRHEKPGGLLKGGASCCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcagcgcggccggggagctggcgctcatcgcgctgggttttttattacctgtgtgt
catgccttggagaacacgacatctgccttgaatggtcctccagtggcggcagcagtcaga
tcccattttaatgagtgccccgattcccacagtcagttctgcttccatgggacctgcaga
tttttggtgcaagaggataagccagcatgcatctgccattctgggtatgtcgggacgcgc
tgcgaacatgcagacctccttgccgtggtagctgccaaccagaagaaacaaaccataact
gccttggtggtggtgtcagtggtagcatcagtcgtacttattgtggtgtgtgtgctaata
cactgctgtcgggtaaggaagcattgcgagtggtgccgagcttttgtctgcagacacgag
aagcctggtgggctcctgaaggggggagcttcttgctgtcattcagagacagtggtctga

DBGET integrated database retrieval system