KEGG   Alligator mississippiensis (American alligator): 102571564
Entry
102571564         CDS       T03087                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04012  ErbB signaling pathway
amj04068  FoxO signaling pathway
amj04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102571564 (CDKN1B)
   04068 FoxO signaling pathway
    102571564 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102571564 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 102571564
NCBI-ProteinID: XP_006265784
LinkDB
Position
Un
AA seq 165 aa
MSDVRISNGSPTLERMEGRQAEHPKPSACRSLFGPVDHEELSRDLQKHRQELEEACQRKW
NFDFQLHRPLRGRFEWRALEPGASPDFYSRPTRLPKGKGAGDTRCAPRAACADPAAGQRK
RPAPDDSSPQNKRANTAEEEVSEDSHSASTVEQTPKKSSPRQHQT
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtccgacgtgcgcatttctaatgggagcccgaccctggagcggatggaggggaggcag
gcggagcaccccaagccgtccgcctgcaggagcctcttcgggccggtggatcacgaggag
ctgagcagggacttgcagaagcaccggcaggagctggaggaggcctgccagaggaagtgg
aacttcgacttccagctccaccggcccctgcgcggccgcttcgagtggcgggcgctggag
cccggcgcctcgcccgacttctactcgcggccgacgcggctgcccaagggcaagggcgcg
ggggacactcgctgcgcgccgcgcgccgcctgcgccgacccggccgccgggcagaggaag
cggccggcccccgacgactcctctcctcagaataaaagagccaacacagcagaagaagaa
gtctcagaagactcccacagtgccagcacagtggagcaaacgcccaagaaatccagccca
agacaacatcaaacgtga

DBGET integrated database retrieval system