KEGG   Alligator mississippiensis (American alligator): 102571615Help
Entry
102571615         CDS       T03087                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00430  Taurine and hypotaurine metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102571615 (CSAD)
Enzymes [BR:amj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     102571615 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DUF4910 DUF739
Motif
Other DBs
NCBI-GeneID: 102571615
NCBI-ProteinID: XP_006278707
UniProt: A0A151NY80
LinkDB All DBs
Position
Un
AA seq 493 aa AA seqDB search
MAEADLLDVPALDKAAGEEFLQEAFGVILEEAVRRGTDVAEKVCDWKEPEDLRHLLDLEL
RGHGEPQPQVLQRCRDIIRYSVKTCHPRFFNQLFSGLDYHALAGRMITETLNTSQYTYEI
APVFVLMEEVVLQKLRELVGWGSGDGIFCPGGSISNMYAMNVARYHRFPDCKRRGLWALP
RLAVFTSKECHYSIQKGAAFLGIGTDNVYLVGADERGKMIPAELEKQISQAQVEGAVPFF
VSVTCGTTVLGAFDPLVAVADVCERHGLWFHVDAAWGGSVLLSQKHRHLLAGIERANSVA
WNPHKMLTTGLQCSAFLLRNTSGLLHRCHSAGATYLFQPDKFYNVAWDTGDKTVQCGRKV
DCLKLWLLWKAVGTEGLEKRVDRAFACTRYLVEEIKKREGFQLVMEPEFINLCFWFVPPS
LRGKQAQADYWERLGKVAPAIKERMMKAGSMLVGYQPHGSKANFFRQIVTSPLVTRQDLD
FFLDEIERLGRDL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggccgacctcctggatgtgcccgccctggacaaggcagccggcgaggagttt
ctgcaagaggcctttggggtcatcctggaggaggccgtcaggagggggacagatgtcgcc
gagaaggtctgcgattggaaggagcctgaggacctgcggcacctgctggacctggagctg
cgcggccacggggagccccagccgcaggtgctacagcgctgccgcgacatcatccgctac
agtgtgaagacatgccacccccggttctttaaccagctgttctccgggctggactatcac
gcgctggccggacggatgatcacagagaccctcaacaccagccagtacacatacgagatc
gcgcccgtctttgtgctcatggaggaggtggtgctgcagaagctgcgggagctcgtgggc
tggggcagcggagacgggatcttctgtccaggcggctccatctccaacatgtatgccatg
aacgtggcccggtaccaccgctttcccgattgcaagcgccggggcctctgggcgctgcca
cggctggctgtcttcacgtcgaaggagtgccactactccatccagaagggagctgctttc
ctgggcatcggcacagacaatgtctacctggtcggcgccgatgagaggggcaagatgatc
ccggccgagctggagaagcagatcagccaggcacaggtcgagggcgctgtgcccttcttt
gtcagtgtcacctgtggcaccactgtcctgggggcctttgacccgctcgtggccgtggct
gacgtgtgtgagcgccacgggctctggtttcatgtggatgctgcatggggtggcagcgtc
ctgctgtcccaaaagcaccggcacctcctggctgggattgagagggcaaattcggtggcc
tggaacccccacaagatgctgacgactggcttgcagtgctcagccttcctgcttcgcaac
acatctggcctgctgcatcgatgccacagcgccggagccacctacctcttccagcctgac
aagttctacaacgtggcctgggacacaggcgacaagacagtgcagtgcgggcgcaaggtg
gactgcctcaagctgtggctgctgtggaaagccgtgggcaccgaggggttggagaagcgt
gtggaccgcgcttttgcctgcacccggtacctggtggaggaaataaagaagcgggagggt
ttccagctggtgatggagcctgaattcatcaatctgtgcttctggttcgtgccacccagc
ctgcgtggcaagcaggcccaggccgactactgggagcgtttggggaaggtggccccagcc
atcaaggagcggatgatgaaggcgggctccatgctggtgggttaccagccacacggcagc
aaggccaatttcttccgccagatcgtcaccagccccctggtcaccaggcaggacctggac
ttcttcctggacgagatcgagaggctgggcagggacctgtag

DBGET integrated database retrieval system