KEGG   Alligator mississippiensis (American alligator): 102571871Help
Entry
102571871         CDS       T03087                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amj03036]
    102571871 (HDAC7)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102571871 (HDAC7)
Chromosome and associated proteins [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102571871 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102571871
NCBI-ProteinID: XP_019334217
UniProt: A0A151M669
LinkDB All DBs
Position
Un
AA seq 1002 aa AA seqDB search
MQGLNQAAVTWSASPQTAPMDLRIGQRFVKPGSDTALLALKQTQQLQHQFFLASLHQQQV
EQLTHQQMRVNMESPHHEAEVGQQEQELRQLLNKDKSKRSAVASTVVKQKLAEVILKKQQ
AALERTSNPNPSAMPYRTLEPLDTEGPAPPVLTSFLAQVPSTIDPPEHFPLRKTASEPNL
KVRYKPKKSLDRRKNPLTRKESAPPSLKRRPPEAIDSSPSSSSTPVSGCSSPNDSLPAEH
GALPTGPGLVHETPLAQRLMMQESSLAQFAQQSAATLPTITLGLPATTSGRGEADRHMLS
SLTHGRVPVLNGPVLAGTHPPMFIPASLEQHEPGGTLSPRVIILEPSVTHTPLVAVPGLG
PVPFSFAPSLIPAERLPLPGHHKPLGRTRSEPLPQNPKAIQQQLAYQQHHAQFLERLKQQ
TALGKRMAKSSEKPRLRQIPSSEDMEAEVGHPEGGGERSDQARGRLESARPGASVKEPER
TQKPMQPQEELVLQQQPYMWEPYQRMQQQLLKRQLPADTLVAPSIHGGHRPLSRAQSSPA
TATISLPTQETPTKALALPVQEPPAKPHFTTGLVYDSVMLKHQCSCGDNSNHPEHAGRIQ
SIWSRLQERGLRSQCECLRGRKATLEELQSVHNERHVFLYGTNPLNRLKLDNGKLAGILS
QRMFVMLPCGGVGVDSDTIWNELHSSNAARWAAGSVTELAFKVATRELKNGFAVVRPPGH
HADPSTAMGFCFFNSVAIAARQLQQKGKLSKILIVDWDVHHGNGTQQVFYRDPDILYISI
HRHDDGNFFPGSGAADEVGSGLGEGFNVNVAWTGGLDPPMGDPEYLAAFRTVVIPIAHEF
SPDVVLVSAGFDAADGHLPPLGGYKVSAKCFGYMTKQLMSLAGGAVVLALEGGHDLTAIC
DASEACVSALLGNEPDPLPEESLRQKPNPNAVRSLETVIQVQSKYWSTVQRFASKVGCSF
LEAQHHEAEEVETVTALASLSVAVMAEKRAQDEPMEEEPMNQ
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggactaaaccaggctgctgtgacctggagcgcatccccgcagaccgcccccatg
gacctgcgcatcgggcagcgcttcgtcaagcccggctcggacacggccctgcttgctctg
aagcagacgcagcagctgcagcaccagttcttcctggccagcctgcatcagcagcaagtg
gagcagctcacccaccagcagatgcgggtgaacatggagtccccgcaccacgaggcagaa
gttgggcagcaggagcaggagctgcggcagctccttaataaggacaagagcaaacgaagt
gcggtggccagcaccgtggtcaaacagaagctggctgaggtcatcctgaagaaacaacag
gctgctttggaaaggaccagcaaccccaacccctccgccatgccctacaggaccctagag
ccgctggataccgaggggccggcgcctcctgtgctcaccagcttcctggctcaggtcccc
agcaccatagaccccccagagcacttcccgctgcggaaaacagcctccgagccgaacctc
aaggtgcgctacaagcccaagaagtccctggaccggcgcaagaacccgctgacccgcaag
gagagcgcgcccccttcgctgaagaggcggccgccggaggctatcgactcgtcccccagc
agcagcagcaccccggtgtccggctgcagctcccccaacgacagcctcccggcggagcat
ggggccctgcccacggggcctggcttggtgcacgagacgccactggcccagcgcctgatg
atgcaggagagctcactggcccagtttgcccagcagagcgcggccacgctaccaaccatc
acactgggactgcccgctaccaccagtggcaggggagaagcagaccgccacatgctctcc
agcctgacccatggacgggtgccggtgctgaatgggcctgtcctcgctggcacgcacccg
cccatgttcatccctgccagcttggagcagcacgagcctggggggaccctttccccacgt
gtcattatcctcgagccctcggtcacccacactccactggtggcagtgccgggcctgggg
ccagtgcccttctccttcgccccctcgctgatccctgctgaacgtcttccgctgcccggg
caccacaagccgctggggcgcacccgctccgagcccttgccccagaaccccaaggccatc
cagcaacagctggcgtaccagcagcaccatgcccagttcctggagcggctcaagcagcag
acggctttgggcaagcgcatggcaaagtccagcgagaagccccgtctacggcagatcccc
tcctctgaggacatggaggcagaggtgggacacccggaaggagggggcgagcgcagcgac
caggccagggggcggctggagtcggcccggccgggggccagcgtgaaggagcctgagagg
acccagaagccaatgcagcctcaggaggagctggttttgcagcagcagccctacatgtgg
gagccctaccagcgcatgcagcagcagctcctcaagcgccagctcccagccgacactctg
gtggcaccgagcatccatggagggcaccggcccctgtccagggctcagtcttctcctgca
acggccaccatctccctgcccacccaggagacgcccaccaaggcactggctctgccagtg
caggagccgccagccaagccgcacttcacgacagggctcgtgtatgactcggtgatgctc
aagcaccagtgctcctgcggggacaacagcaaccacccggagcatgcggggcgaatccag
agcatctggtcccgcctgcaggagaggggactgcgcagccagtgcgagtgcctgcggggc
cgcaaggcgacgcttgaggagctgcagtcggtgcacaacgagcgccacgtcttcctctac
ggcaccaaccccctcaaccgcctgaaactggacaacggcaagctggcagggatcctgtct
cagaggatgttcgtcatgctgccctgtggcggggtaggggtggacagcgacacgatctgg
aacgagctacattcatccaatgctgcccgctgggccgcgggcagtgtcacagagctagcc
tttaaggtggccacgagggagctgaagaacggtttcgccgtggtgagaccccccggacac
catgcggacccctccacagccatgggcttctgcttcttcaactcagtggccatcgcggcc
aggcagcttcagcagaaggggaaactcagcaagatcctcatcgtggactgggatgttcac
cacggcaatgggacccagcaggtgttctaccgggaccccgacatcctctacatctccata
caccgccacgacgacggcaacttcttccccggcagcggggcggctgacgaggttggctct
ggcctcggcgagggctttaatgtcaacgtggcctggactggtggcctcgacccccccatg
ggagacccggagtacttggcagctttcaggacagtcgtgataccaattgcccacgagttc
tccccggacgtggtgctggtgtctgcggggttcgatgcagctgatggccacctgccaccc
ctgggaggctacaaagtctctgccaagtgcttcggctacatgaccaagcagctgatgagt
ctggcaggaggagccgttgtcctcgccctggaaggtggccatgacctcacagccatctgc
gacgcctcggaggcctgtgtctcagccctgctgggcaacgagccggatcccctccccgag
gagagcttgaggcagaagcccaaccccaacgccgtgcgctccttggaaacagtgatccag
gtccagagtaaatactggagcaccgtgcagcgctttgcttccaaggtcggctgctccttc
ctggaagcacagcaccacgaagcggaggaggtggagacggtgacagccttggcctcactg
tcggtggccgtgatggcagagaagagagcacaggacgagcccatggaggaggagcccatg
aaccagtga

DBGET integrated database retrieval system