KEGG   Alligator mississippiensis (American alligator): 102571996Help
Entry
102571996         CDS       T03087                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amj01002]
    102571996 (TMPRSS9)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102571996 (TMPRSS9)
Peptidases [BR:amj01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102571996 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102571996
NCBI-ProteinID: XP_019346785
LinkDB All DBs
Position
Un
AA seq 1094 aa AA seqDB search
MEQMDVALKPVPSTERVKLAAFSICCKVTVAIVFVGGIAGLSFMILLACHPRRELSFEHT
VELRGIVYDNSLQRETSDYYRMLTPTLERLFLTSFRSSQLEGSCASCTILQYSRNGNSSV
IVHFRLRFIHQASQPLSSSLEEEAFTRGLTEALNKQGIPLATYGTISSAFLTRPSEASPY
GIELKSGSCPGNTFACKNSQCVWKENPECDGHADCLDASDEADCDCGSRPAMQTANRIVG
GSKASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFNEFQDPKVWAAYAGTTSLSG
IDPSTVKAGIARIITHPSYNADTADFDVAVLELASPMAFNKYIQPVCLPGAGHHFPAGKK
CLISGWGYLKEDFLVKPETLQKATVELLDQVLCSSLYSYALTDRMVCAGYLEGKIDSCQG
DSGGPLVCEEPSGKFFLAGIVSWGIGCAEARRPGVYARVTKLRDWILDAVSASPAFTALT
LPETPSSTNSSSATTEGISNSITSTPRAISTISSAPATSKSATTARPQECGGRPGLSKPN
KIVGGFNASRGEIPWQVSLKEGSRHFCGATVVGERWLLSAAHCFNQTKLEYIKAYIGTTS
LNGADGNTVKVSIKKVVQHPSYNPIILDFDVAVLELASPLLFNKYIQPVCLPLAVQKFPV
GKKCMISGWGNIQEGNITKPESLQKASVGIIDQKTCNVLYNFSLTDRMICAGFLEGKVDS
CQGDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYSRITKLKDWILDIISPLPAPE
AGTSPSSATTRACTTTSSTAWTSTSTSKAATSPADRTTSKAAATTSTTTRKATAAVPKTS
GPAKPTQLPDCGMTPAVAFNKIVGGSAAARGEWPWQVSLWLRRKEHKCGAVLIAEKWLLS
AAHCFDVYSDPKMWVAFLGTPFLTDIDGRVEKIYRIYKHPFYNVYTLDYDVALLELTTPM
KYTSTIKPICLPDNSHTFREGSRCFITGWGSTKEGGFMSKQLQKAAVNVIGDQACKKFYP
IQISSRMVCAGFPQGAVDSCSGDAGGPLACKEPSGRWFLAGITSWGYGCARPYFPGVYTK
VTAVRGWIAQNLKL
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atggaacagatggatgtagctctaaagccagtgccaagcacagagagggtgaaattggca
gctttcagcatatgctgtaaggtaacggttgctatcgtatttgtgggtggcattgctggc
ctatccttcatgatcctattggcctgtcaccctagacgagagctcagctttgagcacact
gtggagctaagaggaattgtgtatgacaacagcttacaaagggagacatcggactactac
cgaatgctgacccccactctggaaaggctgtttctaaccagtttccggagttctcagctg
gaggggagctgtgctagctgcacgatcctgcagtacagcaggaatggaaactccagtgtg
attgtccatttccgtctccgcttcatccaccaagcttcccaacctttgagctccagcttg
gaggaagaggcattcacacgtgggctaacagaagcactgaacaaacagggtatccctctg
gctacctatgggactatatcctcagcctttctcacaagaccaagcgaggcatcaccatat
ggaattgaattgaaatcaggcagttgccctggaaatacatttgcttgtaagaacagccag
tgtgtatggaaagagaacccagagtgtgatggccacgctgactgcttggatgcctctgat
gaggcagactgtgactgtgggagtcgacccgccatgcagacagccaacaggattgtggga
ggctccaaagcctccagaggggagtttccatggcaagtcagcctgagggaaaacaacgag
catttctgtggtgcagccatcctcactgagaagtggctggtgtctgctgctcactgcttt
aatgagtttcaggacccaaaggtctgggctgcctatgcgggaaccacctctctcagtggc
atcgaccccagcactgtgaaagctggcattgcacggataatcacacacccttcttataat
gcggatactgctgattttgacgtggctgtgctggagcttgcaagtcctatggcctttaac
aagtacatccagcccgtgtgcctaccaggagcagggcaccactttcctgctggcaagaag
tgtctcatctctggctggggctaccttaaggaagactttttggtaaaaccagagaccttg
cagaaggcgacagtggagctgctggaccaggtgttgtgctctagcctgtatagctatgcc
ctcactgacaggatggtgtgcgctggctacttggaggggaaaattgattcatgccagggt
gactctggtggccccctggtttgtgaagaaccatctggcaagtttttcctagcaggcatc
gtgagctggggaatcggctgtgctgaagccaggcgaccaggagtttatgcccgagtgacc
aagctcagagactggatccttgatgctgtctctgcctcccctgccttcacagcactcacc
ctcccagaaacaccttctagcacaaacagcagttctgccaccactgaagggatcagcaac
agcatcaccagcactcctagagctatctccactatctcctcagccccagccaccagcaag
tcagctaccactgccaggcctcaagaatgtggcggacgacctggtctctctaaacccaac
aagattgtgggaggattcaatgcttccagaggagagatcccctggcaagtcagcctgaag
gaagggtcgagacatttctgtggagccaccgtcgttggagagcgctggctgctgtcagca
gctcactgtttcaatcagacaaagctggaatatatcaaagcctacataggaaccacatca
ttaaatggagcagatggcaacacagtgaaagtcagtataaagaaagtggtgcagcaccct
tcctacaatcctatcatcttggactttgatgttgctgtattagaactggcaagtcccctg
ctcttcaacaaatacatccagcctgtgtgtctccctctagctgtgcagaagttccctgtt
ggcaagaagtgcatgatttctggatggggaaatatccaagaaggcaacatcaccaagcct
gaaagcctgcagaaagcctctgttggcatcattgatcagaagacctgcaacgtcctctac
aacttttcccttactgacaggatgatctgtgctggcttcctagaagggaaggtcgactca
tgccagggggactcagggggaccactggcctgcgaggagaccccaggcgtgttttatctg
gctggcattgtgagctggggaattggttgtgcccaagccaagaagccaggggtgtactcc
aggataaccaagcttaaagactggatcctcgacatcatctcacccttgcctgcccctgaa
gcaggcacttcacccagctcagccactacaagagcttgcaccacaaccagctccacagcc
tggaccagcaccagcaccagcaaagcagctacaagcccagctgacaggacaaccagcaaa
gcagcagccaccactagcaccaccaccaggaaagcaactgctgctgttccaaagacaagt
ggtcctgccaaacctacccagctgccagattgtggcatgactcctgccgtagccttcaat
aagattgtcggcggaagtgctgcagctcggggtgagtggccctggcaggtcagtctctgg
cttcggcgaaaggagcacaagtgtggagccgtcctcatcgctgaaaagtggctactttca
gcagctcattgctttgatgtctacagtgaccccaagatgtgggtggcctttctggggaca
cctttcctgaccgacattgatgggagggtggagaaaatctaccgcatctacaagcaccca
ttctacaatgtttacaccctggactacgatgtggcactgttggagctaactacgcctatg
aaatacaccagcaccatcaaacccatctgtctcccagacaactctcatacgttccgggaa
ggctcaagatgcttcatcacaggctggggctccaccaaggaaggaggctttatgtccaaa
caactgcaaaaagcagccgtaaatgtaattggtgatcaggcctgcaagaagttttacccc
atccagatcagcagcaggatggtgtgtgctggctttccacagggcgctgtcgacagctgt
tcgggcgatgcaggtggccccttggcatgcaaggaaccttcaggaagatggtttctcgct
ggaatcacaagctggggctatggctgtgcaaggccatacttccctggtgtttacaccaaa
gtaacagctgtccggggctggattgcacagaacctcaagctgtaa

DBGET integrated database retrieval system