KEGG   Alligator mississippiensis (American alligator): 102572123Help
Entry
102572123         CDS       T03087                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00052  Galactose metabolism
amj00500  Starch and sucrose metabolism
amj01100  Metabolic pathways
amj04142  Lysosome
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102572123
   00500 Starch and sucrose metabolism
    102572123
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102572123
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amj04147]
    102572123
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102572123
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102572123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102572123
NCBI-ProteinID: XP_006274825
LinkDB All DBs
Position
Un
AA seq 928 aa AA seqDB search
MKSYQKLTTDVPQPAASRVEEEGADGKPSCFQKLSTWWLGGCLLAVAILLSAGTVWVLRQ
ASKGRHAQTPPEKCSSVTEPLRFDCYPERNVVVTQELCEARGCCFIERDQASGSRQGVPW
CFYPPDFPSYVLESLNQTELGMVGLLRRKVKAYYPRDIETLQLSVEFETDTRLHIKITDS
SSPRYEVPLQVPRATKRAENPAYSLDFSREPFGLVLKRRASGAVLLNTTVAPLIFADQFL
QISTTLPSTFLYGLGEHRSTFLHSLDWNTLTLWARDVPPTESYNLYGSHPFYLLLEEGGA
AHGVFLLNSNAMEVALQPAPSLTWRTIGGILDFYIFLGPDPNMVIQQYQQVIGLPAMPPL
WGLGFHLCRWGYGTSNETWQTVKAMRNYQIPQDAQWNDIDYMEGNRDFTFDPQAFNTLPQ
LVEDLHKHGQHYVMILDPGISSTNPRGSYWPFDEGLRRGIFINTTEGQPLIGQVWPGLTA
FPDFSNQDTHQWWLENLKRFHAYVPFDGLWIDMNEPSDFMDGSVDGCPAGDLDRPPYVPA
VLGGSLSAKTLCASAKQNASVHYNVHNLYGLMEAKATASALIQIRGKRPFVISRSTFPSQ
GRYSGHWLGDNRSEWKDMSWSIPGLLSFSLFGIPLVGADICGFSGTSSEELCARWMQLGA
FYPFARNHNTQNEKAQDPTAFNSEVRTAMKEVLLTRYALLPFLYTLFHRAHLLGDTVMRP
LFFEFPQDTVTYSIDKQFLWGESLLVTPVLEPGADSVIGYFPRGLWYDYYTGSSVNSSGE
MLKMAAPLDHINLHIREGAVLPTQKPETTSGASRGNPLRLVAALSPNAVAWGDLFWDDGE
SLDTFEKDNYSYLVFNVTQNVFTSTVLHANVEATYVTVDTLTVYGVRGPPTRVTVNGEEH
PFSYLDNQVLTVSDLHLSLSQGFSIRWM
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctatcagaagctgacaacagatgtcccccagccggctgcatcccgcgtggaa
gaggagggcgcggatgggaagccctcctgctttcagaagctgtccacgtggtggctgggt
gggtgtctgctggcagtggccatcctcctgagtgctggcaccgtctgggtgctcagacag
gcctccaagggccggcacgctcagacgccaccggagaaatgcagctcggtcactgagccg
ctgcgctttgactgctaccccgagaggaacgtggtggtgactcaggagctctgtgaggcc
aggggctgctgcttcattgagagggaccaggcctcaggcagcagacaaggagtgccatgg
tgtttttacccccccgacttccccagctacgtcttggaaagcctgaatcagacggagctg
ggaatggtgggcttgctgaggaggaaggtaaaggcctattaccccagagacattgagacg
ctgcagctgagcgtggagtttgagacagacactcggttacacataaagatcaccgattcc
agcagccctcggtatgaagtccccctgcaggtccctcgggccacgaagagagcggagaac
cctgcctacagcctggatttctccagggagccgtttgggctggtgctgaagcgaagagca
tcaggggctgtgctgctgaacacaactgtggctcccttgatcttcgctgaccagtttctt
cagatttccaccaccctcccttccacatttctctacggacttggggaacaccgtagcacc
ttcctgcacagcctggactggaacaccctgactctctgggctcgggacgtccctcccacg
gagtcgtacaacctgtatggatctcacccgttctacctgctgctggaggaagggggagca
gcacatggtgtcttcctcctaaatagcaacgcaatggaggtggccctgcagccggccccc
agcctgacctggagaaccatcgggggcatcttggatttctacatcttcctgggtccggat
cccaacatggtcatccagcagtaccaacaggtgataggtctccctgccatgccacctctc
tgggggctcgggttccatctgtgccgctggggctatgggacaagcaatgagacctggcag
accgtgaaagccatgaggaactaccagataccacaggatgctcagtggaatgacatcgat
tacatggaagggaaccgagacttcaccttcgatcctcaggcattcaacacactcccccaa
ttggtggaagacctccataagcatggccagcactacgtcatgatcctggaccctgggatc
agcagcactaatcctcgcggatcttactggccgttcgacgaaggtttgaggcgtggaata
tttataaataccaccgaggggcaaccgctgattggacaggtgtggcccggcctcactgcc
ttcccagacttctccaaccaggacacacaccagtggtggctggagaacctgaagcgcttc
catgcttatgtcccctttgatgggctttggattgacatgaatgagccgtctgacttcatg
gatgggtcggtggatggctgtcctgcaggggaccttgacaggccgccatacgtgcctgct
gtgctaggagggtccctctctgcaaagactctctgtgcttcagcaaagcagaacgcttct
gtgcactacaacgtccacaacctctatgggctgatggaagccaaagccacagccagtgcc
ttgatccaaatccgagggaaacgccctttcgtgatctcccgctccaccttccccagtcag
ggcaggtactcagggcactggctcggtgacaacaggagcgagtggaaggacatgtcgtgg
tcaatcccaggcctgctgagcttcagcctttttgggatcccgctggtcggggcagacatc
tgtggcttctcaggcacctcctcagaggagctctgcgctcgctggatgcagcttggcgcc
ttctacccctttgcccgaaaccacaacacccagaatgagaaggcccaagaccccacagcg
ttcaactcggaagtacggacagccatgaaggaggtgctgctgacacgctatgccctgctg
cccttcctctacacactcttccaccgggcgcacctcctgggtgacacagtcatgcggccc
ttgttttttgagttcccgcaggacacggtcacgtactccattgataaacagttcctgtgg
ggggagagcctgctggtgacaccagtgctggagcctggagcagactcggtgattggctac
ttcccccgagggctgtggtacgactactatacgggctcgtctgtgaacagcagcggggag
atgctgaagatggcagctccgctggaccacatcaacctgcacatccgggagggtgccgtt
ctccccacccagaaacccgagaccaccagcggggcaagccgggggaacccactgcgcctg
gttgcagctttatccccgaacgctgtcgcctggggggacctcttctgggacgacggtgag
agcctggacaccttcgagaaggacaactactcctacctggtgttcaacgtcacacagaac
gtcttcacctccactgtcctgcacgccaacgtggaagccacctacgtcactgtggacacg
ctgacggtctatggggtccggggtccgcccacgagagtcaccgtcaatggtgaagagcat
cccttctcctacctggacaaccaggtgctcacggtgagcgaccttcacctcagcctgagc
cagggcttctccatcaggtggatgtga

DBGET integrated database retrieval system