KEGG   Alligator mississippiensis (American alligator): 102572248Help
Entry
102572248         CDS       T03087                                 

Gene name
LTK
Definition
(RefSeq) leukocyte receptor tyrosine kinase
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102572248 (LTK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:amj04090]
    102572248 (LTK)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102572248 (LTK)
Protein kinases [BR:amj01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   102572248 (LTK)
CD molecules [BR:amj04090]
 Proteins
  102572248 (LTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102572248
NCBI-ProteinID: XP_019352006
LinkDB All DBs
Position
Un
AA seq 1451 aa AA seqDB search
MDCLSHLLSPAQVFLWITMLVAVSCSGSYVKNTYLLNPPPSVSAGRDGKISSDRPLGPET
SCNIGSGCSWITSVGASRKPDWVLSSVGVLVPQEQQQLLENSSSIGDIEAGDILLLNATR
PSDRCEFSLHSPVLPRSSESCMLELAIYLPGAAPLLQGLAVKVRHVETNQDIVIPLRVGH
EKDGWVKWKVLMAEIGQVKRPFEIFLLYSNCGAQEAGLLALGSLQLRNCFYDNGSQGVSR
DDKSPAFPCPHGDCISHLQVCDFHSDCPAKEDEGALCGSLPKGAHCSFEQDPCGWMLKDP
TASPWSIMSFLDTTQEASFIGSALQDTVGDFLYLRANSSQTGGVAKAYSASLPARMASGD
YQVQFSVHIFGNYNGTLSFSVQEETDGVCTSLWERTGSWSDNWFLITLQIPVLQNWFHLQ
LLATWGWNSQADIAVDNITFGLDCFTDAITERRHSYVDGKHQYPQEIGIMDQHLLNPLEE
PFLSGDISIVFWWFTTCGASGPQGPTQAQCDSAYQNTNVSVTVEKEGKLRGVQAWKVPAT
NRYMISAYGAAGGKGAKNHNKRSHGVFISATFQLEKDELLYILVGQQGEDACPGGNVQTQ
KICLGESSLIEDNYKKTKDLKEWAGGGGGGGGATYVFRQKDGTFEPLLIAAGGGGKAYLK
DQDNLLDDIPLEQLENNTAVPGVNGKTGAAGGGGGWQDITQVPRAGKSLLEGGEGGQACP
QALNKLQWATSGGFGGGGGACTSGGGGGGYRGGHVSDSDEITADGQDGISFVNPTGEIFL
HPLAAMESHGEVEIQIYLNCSHCHSGNCKRDLETNLPICICEMGSVLASDNITCTVPHGP
IPEGHLPLPLLLAVVAAIVVLGMALTCGSLSFLYHRKKQQLEGARARLQSPEYKLSKIRT
STIMTDYNPNYCFAGKAATLNELKEIPRKNISLLRALGHGAFGEVYEGTVVGITGDPNPL
QVAIKTLPEVCSEQDEMDFLMEALIISKFNHQNIVRCIGVSLQTLPRFILLELMAGGDMK
SFLRQNRPRVNQPSTLTMQDLLNIARDIACGCRYLEENHFIHRDIAARNCLLTCTGADRV
AKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGIFTSKTDTWSFGVLLWEIFSL
GYMPYPCKTNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHSPEYRPNFSTILERIKY
CTQDPDVINTELPIECGPAPEDEGSTVIRPNASSGTVPLMVSPSLTPQMAPRMLEAHQAG
HKLGQCPQELMVENLGNWTVRGPSLPCLSDSNSSGSWFQQTSNHRLKNKTKNLWNPTYGS
WMLEHICHSSPNSKLKVATEREDSGFDGNCSSSPSSRESPASPSRRHAPHVDVGGIELVK
LQTFPCGNVNYAYDDLCYNTDQASSLATDRAPVLRRTSLRRDEKPFFKPEKTSRERDSGL
SLSDDLSVTPV
NT seq 4356 nt NT seq  +upstreamnt  +downstreamnt
atggattgtctatcacatctgctcagtcctgcccaggtgttcctgtggatcaccatgctg
gttgcggtctcctgctctggatcatatgtgaaaaacacttatttgctgaatccccctcca
agcgtgtctgctggtagagatgggaagatatcatctgataggcctctgggtccagagact
tcttgtaacattgggtcaggctgctcttggataacatctgtgggtgcctctagaaaacca
gactgggtattatcttcagtgggtgtcttggtgccacaggagcagcaacagcttctggag
aacagttcatctattggagacatagaagccggagacattcttctcctgaatgctaccagg
ccctcggatagatgtgagttcagtctccatagccctgtcctgcccaggagctcagagtcc
tgcatgttggagctggccatatacttacctggagctgctcctcttctccagggactcgca
gtcaaagtccggcacgtggagacaaaccaggacatagtcatccctctgagagttggacat
gaaaaggatggctgggtgaagtggaaagttttgatggctgagattggccaagtgaagaga
ccttttgagatttttctgctgtattcaaattgtggagcacaagaggctgggctgctggca
ttgggctctttgcagctcaggaactgcttctatgacaatggaagccaaggtgtttctagg
gatgacaagagccctgctttcccttgcccacatggggactgcataagccatctgcaagtc
tgtgattttcacagtgactgtcctgccaaagaggatgaaggagccttgtgtggcagtctt
cccaagggagcacactgttcttttgaacaggatccctgtggctggatgttgaaagaccct
acagcttccccttggtccattatgagctttctggacacaacacaagaagcttcattcata
ggatctgccctacaagacactgtaggtgacttcttatacctacgagcaaacagcagtcag
acaggtggtgttgccaaggcttacagtgccagcttgcctgccaggatggccagtggagat
taccaggtccaattctcagtgcatatttttggcaattacaatggtaccctctcattctct
gtccaggaagagacagatggagtctgtacctccctgtgggaaaggacagggagctggagt
gacaactggtttctaatcactctgcaaattccagtgctccagaactggtttcacctgcag
cttctggcaacctggggctggaattcccaagctgacattgctgttgataatattactttt
ggactggactgcttcactgatgctataacagaaagaagacacagctatgttgatggaaag
caccaatacccacaggaaatcggaatcatggatcagcatctgttgaaccctttggaagag
ccatttctctcaggggacatctctattgttttctggtggttcacaacttgtggtgccagt
ggtcctcaagggccaactcaagcacagtgtgatagtgcctaccagaacaccaatgtgtct
gtcactgtggagaaagagggtaaactccgaggagtacaagcgtggaaagtgccagcaaca
aaccgatacatgatttctgcctatggagcagctggagggaaaggagccaaaaaccacaat
aagagatcacatggagtcttcatctcagctaccttccagctggagaaagatgagctcctc
tacatcttagtggggcagcagggggaagatgcctgcccagggggaaatgttcagacccag
aagatctgcctgggggagtcatctctcattgaagacaattacaaaaaaacaaaggacctg
aaggagtgggctggaggagggggtggaggaggaggagccacctacgtctttagacagaag
gatgggacttttgaacctttgctgatcgcagcaggaggaggaggaaaggcatacctgaag
gaccaagacaacttgctggatgatatacccctggaacagcttgagaacaacacagcagtg
cctggagtcaatgggaaaacaggggcagcaggaggagggggtggctggcaggatatcacc
caggttcctcgggctgggaagtccctcctggaaggtggagagggaggtcaggcctgtccc
caagcactaaataagcttcagtgggcaacctcaggtggttttggtggaggaggaggagct
tgtacttctggtggaggaggcggaggctacagaggtgggcacgtgtcagatagcgatgag
atcactgctgatgggcaggatggtatttcttttgtgaatccaactggggaaatcttcctg
catcccctggcagccatggagagtcatggtgaggtggagattcagatctacctgaattgt
agccactgccactcaggcaactgcaagcgggaccttgagaccaatctgccaatctgcatt
tgtgaaatgggctctgtgctagccagcgacaacatcacctgcacagtgcctcatggcccc
atcccagagggacacctgccactcccactcctcctggctgtggttgctgcaattgtggta
cttggaatggccctcacttgcggcagcctctccttcctctatcaccgtaagaagcagcag
ctggaaggagctagagcacgactgcagagcccagaatacaaactgagcaaaatccgtacc
tccaccatcatgacggattacaaccccaactactgctttgctgggaaggctgccacgctg
aacgagctgaaggagatccctcgcaagaacatctccctgcttcgggcattaggacatgga
gcatttggcgaggtttatgaggggacagtggtaggaatcactggagatcccaacccgcta
caggtggccatcaagacattgccagaagtctgctctgagcaggatgagatggatttcctg
atggaggcactgataataagtaagttcaatcaccaaaacatagtgcggtgcattggtgtg
agcctgcagacgttgcctcgcttcattctgctggagctcatggctggtggagacatgaag
agcttccttcggcagaatcgaccacgtgtgaaccagccatccactttgacaatgcaagac
ctgttgaacattgccagagacattgcctgtggttgcagatacctggaagagaatcacttc
atccacagggacatagctgcaaggaactgcctgttgacctgcactggggcagatcgagtc
gccaaaattggtgattttggaatggcccgggatatctacagggcaagctactatcgcaaa
ggcgggagagccatgctgcctgtcaagtggatgccaccagaggctttcctagaggggatc
ttcacctccaagactgatacatggtcttttggtgtgctgctgtgggagatcttttcattg
ggctatatgccatacccttgcaaaaccaaccaagaagtgctggaatttgttactagtgga
ggaagaatggatccaccaaaaaactgcccaggaccagtctatcggatcatgacacagtgt
tggcagcacagcccagagtaccggcccaacttctccactattctggaaagaatcaagtac
tgcacacaggatcctgacgtaatcaatactgagttgcccattgaatgtgggccagctcca
gaagatgagggaagcacagtgatacgcccaaacgcttccagtgggacggttcccttgatg
gtgagcccttccctgacccctcaaatggctcccagaatgttagaagcccatcaggcaggg
cataaacttggacagtgtccacaggaactgatggtagagaatttgggcaactggactgtc
agaggacccagcctgccatgtctctctgattccaatagcagtgggtcctggttccaacag
acttcaaatcacagactgaagaacaaaacgaaaaacctttggaacccaacatacggttcc
tggatgttggagcatatctgccattccagccctaactccaagctcaaagtggccacagaa
cgagaagactcgggctttgatgggaattgcagctcttcccctagttctcgggaatctcca
gcatctccaagccggagacatgctcctcacgtggatgtcggtgggatcgaattggtgaag
ctacagactttcccatgtggtaatgtgaattatgcatatgatgacctctgctacaacact
gaccaggcttcctctttggcaacagacagggcaccagtactgagacgcaccagtctgcga
agggatgagaagcctttttttaagccagagaaaacatcacgagagagggactctggcctc
tccttatcagatgacctgagcgttacacctgtataa

DBGET integrated database retrieval system