KEGG   Alligator mississippiensis (American alligator): 102573702
Entry
102573702         CDS       T03087                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04060  Cytokine-cytokine receptor interaction
amj04068  FoxO signaling pathway
amj04144  Endocytosis
amj04218  Cellular senescence
amj04350  TGF-beta signaling pathway
amj04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102573702
   04350 TGF-beta signaling pathway
    102573702
   04068 FoxO signaling pathway
    102573702
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102573702
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102573702
  09143 Cell growth and death
   04218 Cellular senescence
    102573702
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102573702
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102573702
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102573702
Protein kinases [BR:amj01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102573702
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TNFR_16_TM
Other DBs
NCBI-GeneID: 102573702
NCBI-ProteinID: XP_006258289
UniProt: A0A151M0Y8
LinkDB
Position
Un
AA seq 567 aa
MDYWKRVGLISLLLLSFSCYAWTRRNLKTNLCKWCDYTIPVCEDKVCYSNCNLNSYCENP
YEICVAIWRQDNESISISTLCHNPQLPIENIMVPNYNTSRCIMTHLPREDGAFYICGCVD
EQECNDKLIFENHTNGYSMQQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKQRKRAK
DWSQKHTQHRALPESGKAAEHDEKLSVMIDDNHSHMSSTCANSINHNTELLPIELDEMVG
KGQFAEVWRAKLNHASSGQYETVAVKIFPCEEYSSWKNESQIFTDTSLKHESVLQFLTAE
NRGSGPRKEYWLITAYHSRGNLKDYLSRHILSWMDLQKMAGSLVNGVAHLHSDYTACGRP
KIPIAHRDIKSTNILVKNECECVLCDFGIALRLDPSLTADDFANSGQVGTARYMAPEVLE
SRVNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKSYELPFGSKVQEQPCVDTMRDIV
LHGRGRPEIPSNWLVHQGMHFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILN
NNMDNEAGKTVCPGSEHQASDENRNSQ
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggattactggaagagagtgggtctgatttccctactgctgctatccttctcatgttat
gcctggacacgaaggaatttgaagaccaacttgtgtaagtggtgcgactacacaatcccg
gtgtgcgaagacaaggtatgctacagcaactgcaatttgaactcctactgtgagaatcca
tatgaaatctgtgtggctatatggagacaagacaatgagagcatcagcatcagcactctc
tgccacaacccacagcttcccatagaaaacatcatggttcccaattacaacacctccagg
tgcatcatgacccacctgccaagggaggacggagcattctacatctgcggctgcgtggac
gaacaggaatgcaacgacaagctcatctttgaaaatcacaccaatggatattccatgcaa
cagagcaaagaggtcatccccgtggctgcaataagcctgctccctcctctgctagtggct
gtcatgataacagttatattttacctctgccgcacccaaaagcagaggaagagagccaag
gactggagccagaagcacacacaacaccgggccttgcccgagtcagggaaagctgccgag
cacgatgagaagttgtcggtgatgatagacgacaatcactcccacatgagctcaacctgc
gccaacagcatcaaccacaacactgagctgctccccatcgagttggacgagatggtgggg
aaaggccagtttgcagaggtctggagggccaagctgaatcatgccagctcagggcaatac
gagacagtggctgttaagattttcccttgtgaggaatattcttcctggaaaaatgagagc
cagattttcacagacaccagcctcaagcacgaaagtgtccttcagttcctcacggcagag
aacagagggtctggcccgcgcaaggagtactggctcatcactgcttaccatagtagaggg
aacctgaaggactacctgtcccggcacatactgagctggatggacttacaaaagatggca
ggctcccttgtgaacggtgtggctcatctgcacagtgactacactgcgtgtggcaggcca
aagatccccattgcccaccgagatatcaaaagcaccaacatcctggttaagaacgaatgc
gaatgcgtgctctgcgattttggcatcgccctccgactcgacccttccttaacagcagac
gactttgccaacagcggacaggttggcactgccaggtacatggctccagaagttctagag
tccagagtgaatctggaagatttggagtccttcaaacaaatggatgtctactcgatggcc
ttggttttgtgggaaatggcctccaggtgcgaggtggtaggagaggtaaagagttacgag
ctgccttttgggtcaaaagtccaggagcaaccctgcgtggataccatgagagacattgtg
ctgcacggcaggggacgcccagaaatacctagcaactggctggtgcatcagggaatgcac
tttctgtgcgacaccatcacagagtgctgggatcacgaccccgaggctcggctcactgcc
cactgtgtagcggagcggttcaacttgatggcgcagatggactgcgatgacatcctcaac
aacaacatggacaacgaggctggcaaaacagtttgccccggcagcgaacaccaagccagt
gacgagaacagaaacagccagtga

DBGET integrated database retrieval system