KEGG   Alligator mississippiensis (American alligator): 102575242
Entry
102575242         CDS       T03087                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00232  Caffeine metabolism
amj00983  Drug metabolism - other enzymes
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102575242
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102575242
Enzymes [BR:amj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     102575242
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-GeneID: 102575242
NCBI-ProteinID: XP_006274037
LinkDB
Position
Un
AA seq 290 aa
MNIEKYFSRTGYKGSYDKQDLETLTAVFQHHIRAVPFENLSIHCGETITLELDQVYNKIV
MKRRGGWCMENNQLLNWVLKTLGYDTTILGAYVYNPQQNTYATRMTHLLIKVVIGGKAYI
VDAGFGVSGQMWQPMELISGKDQPQIPGIFRFTENDGVWYNEKIRRKQYIPNQHFSDSDL
LEKRLCRKLYFFSLEPRTVADFQFQCTYLQTSPDSLFTKKSICSIQTTNGFRALIGWTLI
ETTYNYKEDMDVVEFTTLQEEEVEKTLEDKFNIALERKLVPINDKGAYKI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaacattgagaaatatttttcaagaaccggatacaaaggctcgtatgacaaacaagat
ctggaaaccttaactgcagtcttccagcaccacatccgagcggtcccctttgaaaaccta
agcatccactgcggggaaactattactttggagttagaccaagtttacaacaaaatcgtg
atgaagaggcgtggtggatggtgcatggaaaacaatcagctgctaaactgggttctgaaa
acgctggggtatgatactaccattttgggggcatatgtatacaatcctcaacaaaacaca
tatgctacccgaatgacccaccttctcataaaggtggttattggtggcaaagcctatatt
gtggatgcaggttttggcgtgtctggtcaaatgtggcagccaatggaacttatttctgga
aaagaccagccgcagattcctggcatctttcgctttacagaaaacgatggggtctggtac
aatgagaaaataaggaggaaacaatatattcccaatcaacacttctctgattctgatctt
ctagaaaaaagattgtgcaggaaactttacttcttcagtcttgagccacgaacggtggca
gatttccagttccaatgtacgtatcttcagacgtccccagactccttgtttacaaagaag
tctatttgctctattcagaccacaaacgggtttcgggcattaattggatggacgctcatt
gagacaacatacaattacaaggaggacatggatgttgtggaattcacgacccttcaagag
gaagaggtggagaagacactggaggataaattcaacatagctctggagagaaaattagtc
ccaattaatgacaaaggagcatataaaatttag

DBGET integrated database retrieval system