KEGG   Alligator mississippiensis (American alligator): 102575338
Entry
102575338         CDS       T03087                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04020  Calcium signaling pathway
amj04144  Endocytosis
amj04510  Focal adhesion
amj04540  Gap junction
amj04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102575338 (PDGFRA)
   04020 Calcium signaling pathway
    102575338 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102575338 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102575338 (PDGFRA)
   04540 Gap junction
    102575338 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102575338 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102575338 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:amj04090]
    102575338 (PDGFRA)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102575338 (PDGFRA)
Protein kinases [BR:amj01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102575338 (PDGFRA)
CD molecules [BR:amj04090]
 Proteins
  102575338 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 102575338
NCBI-ProteinID: XP_006276273
LinkDB
Position
Un
AA seq 1087 aa
MGTFPRLLLGLGCILTGPWLTFCQLPLPTIFPNKNEMVVQLNSSFTLKCSGDSEVSWQYP
MAEENQKIDIRLEENNSGLFVTVLEVGDASAALTGLYTCYYNHTQVEDGEVEGTDIYIYV
PDPDIPFVPTLQEDQFILIEEGDSTVIPCRTTDPDAQVTLINSEAKPLYAFYDSKQGFIG
NFPAGTYTCKTTVKGVEFKSDEFFIYILRATSQLPVKIEALKTVYKKGETIVVTCVVSHN
EVVNLDWNYPGKVKEKGVIKLDDIKVPHQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENRRVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVHAYPTPKMFWLKDNVTLIENL
TEIVTSSNKIHETRFQSTLKLIRAKEEDSGYYTLVAENEDETKRYTFSLLIQVPALILDL
VDNHHGSAGGQTVRCLAEGTPLPDVEWLICKDIKKCSNDTSWILLTSNISDISMEAHLDE
KNMVESQVTFQKVEETLAVRCIARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKLKKDLDIFGMNPADESTRSY
VILSFENNGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSMYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVECLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDIMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtactttcccaagattactcctgggcctgggatgtatcctaacaggaccatggcta
acattttgccagcttccattgccaactatatttccaaataaaaatgaaatggttgtgcag
ttgaattcctctttcaccctgaaatgctctggggacagcgaagtgagctggcaataccct
atggctgaagaaaaccagaaaatagacattagacttgaagagaacaacagtggcctcttt
gtgactgtgcttgaagtaggagatgcctcagctgctcttactggattatacacttgttat
tacaatcatacccaagtggaggatggtgaagtagaggggacggatatttacatctatgta
cctgatccagatatcccttttgttcctacgctacaagaggatcaattcatcctaatagaa
gaaggcgattccactgttatcccttgtcgtacaactgaccctgatgctcaagtaacctta
attaacagtgaagccaagcccttatatgccttttatgatagcaagcagggcttcatagga
aattttcctgcaggcacatacacatgcaaaacaactgttaaaggagtggagttcaagtcc
gatgagttctttatatatattttgagagctacttcacagctgccagttaagattgaagcc
cttaaaactgtatataaaaaaggcgaaaccattgttgtaacatgtgtggtctctcacaat
gaggttgttaatttagattggaattatccagggaaagtgaaagaaaaaggtgtgataaaa
cttgatgacataaaagttccacaccagaagctggtttacaccttgaccattccggaggca
tcagtgaaagacactggggattatgaatgcactgccagacatgcaaccaaggaggttaag
gaaaataggagagtagtcattacagttcacgacaaaggattcattcatctggagccccag
tttagtcctttggaagctgtcaatctccatgaggtcaaaaattttgtagttgatgtgcac
gcatatccaactccaaaaatgttctggctgaaggacaatgtgaccctgattgagaatctt
accgagattgttactagttcaaataagatccatgagacaaggtttcaaagtacattaaaa
ctgattagagccaaggaagaagacagtggatattacaccttggttgctgaaaatgaagat
gagactaaaagatatactttctcattactaatacaagttccagccttaattctagacctg
gtggataatcatcatggctcagccggaggacagacagtaaggtgcttggcagaagggaca
cctcttcctgatgttgaatggctaatttgcaaggacattaaaaaatgcagcaatgatacc
tcatggatacttctgactagcaacatctcagatattagcatggaggctcatttggatgag
aagaacatggtggaaagccaggtgaccttccagaaggtagaagaaaccctggcagttcgg
tgcattgcaaggaacgaccttggtgctgttactcgggagctgaagcttgtggctcctaca
ttgcgatcagagttaactgtggctgctgcagtcctagtgttgttagtaattgtgattatc
tcactgattgtcctggtcgtcatatggaaacagaagccacgatatgagataagatggaga
gtcattgaatcaatcagtcctgacggccatgaatacatttatgtggacccaatgcaactg
ccatatgactcaagatgggagtttcctagagatggattagtccttggtcgaattcttggt
tctggtgcatttggcaaagttgttgagggaactgcatatgggttaagtcgctctcaacca
gtgatgaaggtagctgtgaaaatgctgaaacccacagcgagatccagcgaaaaacaagca
ctaatgtctgaactgaagataatgacacatcttgggccacatttgaacattgtgaatctg
ttaggagcttgtaccaaatcaggtccaatttacatcattactgaatactgcttttatgga
gatttggtaaactacttgcataagaatagagataattttctaagccgacacccagaaaag
ctgaagaaggacttggacatctttggcatgaacccagctgatgaaagcacaagaagttat
gtaattttatcctttgaaaacaatggagaatacatggacatgaaacaagctgatacgacc
cagtatgtgcccatgctggaaaggaaggagggttctaaatattctgatatccagagatct
atgtatgatcgacctgcttcatacaagaagaaatccatgtcagaatctgaagtcaagaac
ctactttctgatgacagttctgaaggcctcagcctattggacttactgagcttcacctat
caagttgcacggggaatggagttcttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtccttctagctcaaggaaaaattgtgaagatctgtgactttggtctggct
agggacatcatgcatgattccaactatgtctccaaaggcagtacatttcttccagtgaaa
tggatggcacctgagagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctactgtgggaaatattttcccttggtggcacaccttaccctggaatgatg
gttgattctactttctataacaagataaaaagtggctaccgaatggcaaagcctgaccat
gccaccaatgaggtgtatgagatcatggtgaagtgttggaacagtgaaccagaaaaaaga
ccttctttttaccatttaagtgaaattgttgagtgtctgttgcctggagagtacaaaaag
agctatgaaaagattcatctggacttcctgaaaagtgaccacccagctgtcacacgcatg
agaggggactgtgacaacacctatattggtgtcacctacaagaatgaagacaaactcaag
gatagggagagcggatttgatgagcagaggctgagtgctgacagtggatacatcatccct
ctgcctgacattgaccctgtatctgaagatgagcttggcaaaagaaacaggcacagttcc
caaacatctgaagaaagtgctattgagactggttccagcagctctacctttatcaagaga
gaggatgagaccattgaggacattgacataatggatgacattggaatagattcctcagat
ctggttgaggacagcttcctgtaa

DBGET integrated database retrieval system