KEGG   Alligator mississippiensis (American alligator): 102575519
Entry
102575519         CDS       T03087                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04020  Calcium signaling pathway
amj04260  Cardiac muscle contraction
amj04261  Adrenergic signaling in cardiomyocytes
amj04270  Vascular smooth muscle contraction
amj04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102575519 (CACNA1C)
   04020 Calcium signaling pathway
    102575519 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102575519 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102575519 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102575519 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102575519 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amj04040]
    102575519 (CACNA1C)
Ion channels [BR:amj04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102575519 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102575519
NCBI-ProteinID: XP_019344939
LinkDB
Position
Un
AA seq 2173 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGTTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VHGALADTPAEEDPSPCAPQSAHGRQCQNGTECRAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTDNV
AGADIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYQQSNWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMPPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEIEKPAVEEETKEEKIELKSITADGESPPATKINVDDYQPNENEEKNPYPT
TEAPGEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPSNRFRVHCHRIVND
NIFTNLILFFILLSSISLAAEDPVRHTSFRNQILFYFDIVFTVIFTIEIALKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCSDSSKQTLTECRGYFITYKDG
EVTQPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFT
GLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIV
VGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTGINRNNNFQTFPQAVLLLFR
CATGEAWQEIMLACLSGKKCDPESEPANSTEGDHSCGSSFAIFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQ
SDGRSTFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNAN
NTALCRFPSPPNFPSTVSTVEGHGTPLSPTIRVQEAPWKLGSKRTHYYETSGRSGSRDSQ
LAIVCQEEVSQGETYDENLNEDVEYCSEPSLISTEMLSYQDDENRQLTPPENNKGEDARQ
SPRKGFLCSSSLGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQR
SHSPTMFSRLCATPPATPCSRGWPEQTIPTLRLDGAESSEKLNSSFPSIHCSSWYSDRAS
CSSTRRARPVSLTVPSQTGGSGRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEVTTQELA
DACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNPDCRKSQ
EELKDSRIYISSL
NT seq 6522 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattccggaggaaaatcatcaaggttccaactat
gggagtccccgtccagctcatgccaacatgaatgccaatgcagctgcagggcttgcccca
gagcatatccctactccaggggcagctctgtcctggcaggctgctatcgatgctgccaga
caggccaaattgatgggtagtgctggcaatgcaacaatatccacagctagctccacacag
aggaaacggcagcagtatgggaaacagaaaaaacagggtactaccacagctacacgtcct
ccccgggcattgctgtgtttaacactgaaaaatcccatccggagggcatgtatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tatggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcaataggagggaaaggtgccggatttgatgttaaagcactgagggcttttcga
gtgttacgccccttacggctggtatctggagttcctagtctccaggtggttttaaattca
atcatcaaggccatggttcccttgttgcacattgccctgctggtgctgtttgtcataatt
atctatgccatcattgggctggagctattcatggggaagatgcacaagacctgctaccat
gtgcatggggcattagcagatacacctgcagaagaggatccttctccttgtgctcctcag
tcagcacatggacggcagtgtcagaatggcacagagtgcagagctggctgggaaggccct
aagcatggcattacaaactttgacaattttgcttttgccatgttaactgtgtttcagtgc
atcactatggaaggctggacagatgtactgtactgggtcaatgatgccataggaagggac
tggccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttg
gttctcggtgtgcttagcggggagttttccaaggaaagagaaaaggcaaaggcccggggt
gactttcagaagttgcgggagaagcagcaactggaggaggacttgaaggggtacctggac
tggataactcaagcagaagacattgatccagaaaatgaagatgaaggcatggatgaggag
aagcctagaaacatgagcatgcctacaagtgagacggagtctgtaaacacagacaatgtg
gctggagctgacattgaaggagaaaactgtggtgcaaggctggcgcatcggatctctaaa
tctaagtttagccggtactggcgccggtggaaccggttctgcaggagaaagtgtcgagct
gctgtcaagtccaatgttttctattggctggtgattttccttgtgttcctcaacactctc
accattgcctctgaacactaccagcagtcgaactggctcactgaggtccaagatactgcc
aataaggtgctgctagctcttttcacggcagagatgctgctgaagatgtacagccttggt
ctccaggcctactttgtgtctctcttcaaccgctttgactgctttattgtttgtggagga
atcctggaaacaattctggtggagaccaagataatgccaccactgggcatctcagtgttg
cgatgtgtccgactcctgagaatatttaagatcacaaggtattggaattccctgagtaac
ctcgtagcttcattactgaactctgtccgctccatcgcctccttgttgctgcttctcttc
ctcttcatcatcatcttctcactcctgggaatgcagctctttgggggcaagtttaacttc
gatgagatgcaaaccaggaggagcacatttgacaacttcccccagtctctcctcactgtg
tttcagatcctgactggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccaggaatgttggtctgtatttacttcatcatcctcttcatctgt
ggaaactatatcctactgaatgtatttttggccattgcggtggacaatcttgccgatgct
gagagtttgacatctgcacaaaaagaagaggaagaggaaaaagaaaggaaaaaactagct
aggactgctagtccagaaaagaaacaggagatagagaagccagctgtggaggaggagaca
aaggaggagaaaatagagctaaaatcgatcactgctgatggagagtccccacctgctacc
aagatcaatgtggatgactatcagcccaatgaaaatgaagaaaagaatccatatcccact
actgaagctccaggagaggaagatgaggaggagcctgagatgcctgtgggtcctcggcca
cgcccaatgtctgaactgcatctcaaggaaaaagctgtgcccatgccagatgccagtgct
ttctttatcttcagcccaagcaacaggtttcgtgtccactgccatcgcatcgttaatgat
aacattttcaccaacctgatcctctttttcatcttgctcagcagcatctctctggcagcc
gaggaccctgtccgacacacctcctttaggaaccaaattctcttttattttgatatagtt
tttactgtcattttcaccattgaaattgctctgaagatgactgcatatggggctttcctt
cacaagggctccttctgcaggaactacttcaacatcctggatctgctggtagtcagcgtt
tctctcatctcctttgggatccaatctagtgccatcaacgtagtgaagatcttacgtgta
ctacgagtgctcagaccattgagggccatcaacagagccaaagggctaaagcatgtggtc
cagtgcgtgtttgttgccatcagaaccattgggaacatagtgatcgtcaccactttgctg
cagttcatgtttgcctgcattggagttcagttgttcaagggcaaactgtatagctgcagt
gatagctccaagcaaacactcacagagtgcagggggtatttcattacatacaaagatggc
gaggtcacccagccaatgatccagccccggagctgggagaacagcaagtttgactttgac
aacgttttgactgccatgatggcgctctttactgtttcaacttttgagggttggccagag
ttgttgtacagatccattgattcccacatggaagatgttggacccatctataaccacagg
gtggagatctccattttcttcatcatctatatcatcatcattgccttcttcatgatgaac
atctttgttggtttcgtcattgtcacgtttcaggaacaaggagagcaggagtacaagaac
tgtgaactggacaagaatcagcgtcagtgtgtagaatatgccctgaaggctcgtcccctg
aggaggtacatccctaagaaccaataccaatataaagtgtggtatgtggtgaactccacc
tattttgagtacctgatgttcgttctgatcctgctgaacactatctgcctggccatgcaa
cactacggtcagagctgcatgtttaaggaagccatgaatatcctcaacatgctcttcact
ggtctcttcactgttgagatggttctgaaactaatcgccttcaaacctaagggttacttt
agtgatccttggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcatt
ctcagtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttgattgtt
gtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgc
tcttcctctatgaatgcagaggaaaactctcgcatctcaatcacctttttccgactcttc
cgcgtgatgcgtcttgtgaagctcctgagccgaggggagggcatccggacgctgctttgg
accttcatcaagtccttccaggctctcccctatgtggctctactaatagtgatgctattc
ttcatctatgctgtgattgggatgcaggtgtttggtaaaattgcgctgaacgataccaca
ggaatcaaccgcaacaacaactttcagaccttcccacaagcagtactgctgcttttcagg
tgtgccacaggtgaggcctggcaggagatcatgctggcctgcctgtcaggcaagaagtgt
gatcctgaatcagaaccagccaactctactgaaggcgaccattcctgtgggagcagcttt
gccatattttatttcatcagcttctacatgctctgtgccttcctgatcatcaatcttttt
gtagctgttataatggataactttgattacctgacgcgggactggtccattttaggacca
caccacctggatgagtttaaaaggatttgggcagagtatgatcctgaagccaagggacgg
atcaaacaccttgatgtggtgacactgctccggaggattcagcctccacttggctttggg
aagctctgtcctcatagagtggcttgcaagcgcctcgtctccatgaatatgccactaaat
agtgatgggactgtcatgtttaatgctactctctttgcattggtcagaacagcactgagg
atcaaaactgaaggtaacctggagcaagctaatgaggaactgcgagcaataataaagaaa
atctggaagcgcaccagtatgaagctgctggatcaggtcgtgcccccagctggcgatgac
gaggtgactgttgggaagttttatgccactttcctgatccaagagtatttccggaaattc
aagaaacgcaaagaacagggcctagttggcaaaccctcacagaggaatgctctctccctg
caggctggtctgcgcacactgcatgacattgggccagagatccgacgggcaatctcaggg
gacctgacagctgaagaggaactagacaaggccatgaaggaagctgtctctgctgcttct
gaagatgatatctttaggagggctggtggcttgttcggaaaccatgtcagctactaccaa
agtgatggcagaagcaccttcccccagacattcactacccagcgccctttgcacatcaat
aaatctggcaacaaccagggagatactgagtccccatcccatgagaagctagtggattcc
acctttactcctagcagctactcttcttcaggttccaatgccaacatcaacaatgccaac
aacactgccttgtgccgcttcccaagcccacccaattttccaagcactgtcagcacggta
gagggacatggcacccccttgtcacccaccatacgtgtgcaggaggccccttggaaactt
ggatccaaaaggacacattactatgaaacatcgggacgctccggttccagagacagccag
ctggcaatcgtttgccaagaggaagtgtctcagggtgagacttatgatgaaaatttgaat
gaagatgttgaatactgcagtgagccaagcctgatctctactgaaatgctgtcataccaa
gatgatgaaaacagacagctgacgccaccggaaaataacaaaggggaagacgccaggcag
tctccaaggaagggatttctttgctcctcatcattaggtcgaagagcatcatttcatttg
gagtgtctgaagagacagaagaaccaaggtgtagatgtctcacagaagacagttctgccc
ttacatctggtacatcatcaggcactagctgtggcgggtctgagtcccctgctccaaaga
agccattccccaaccatgttctcccggttgtgtgccacaccccctgccacaccctgtagc
cgtggctggccagagcagaccatcccaactttgcggcttgacggagcagagtccagtgag
aaactcaatagtagcttcccgtcgatacactgcagctcttggtactccgaccgtgccagc
tgcagcagcactagaagagcccggccggtctctctcactgtccccagccaaactggaggg
agcggcaggcagttccacggcagtgctggcagccttgttgaagcggtcttgatttcggaa
ggactgatgcagtttgctcaagatccaaagttcattgaggtcacaacccaagagctagcg
gatgcgtgtgacatgacgatagaagagatggaaaatgcagcagacaacattctcaatggt
aacagcaagcagagccccaatggcaacctcttgccttttgttaactgcagggacccaggg
caggacagtgcaggagaggaagaggaagaggtgcaaaacccggattgtagaaaaagtcag
gaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system