KEGG   Alligator mississippiensis (American alligator): 102575554
Entry
102575554         CDS       T03087                                 

Gene name
SLC9A1
Definition
(RefSeq) solute carrier family 9 member A1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04260  Cardiac muscle contraction
amj04261  Adrenergic signaling in cardiomyocytes
amj04371  Apelin signaling pathway
amj04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102575554 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102575554 (SLC9A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102575554 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    102575554 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amj01009]
    102575554 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amj02000]
    102575554 (SLC9A1)
Protein phosphatases and associated proteins [BR:amj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102575554 (SLC9A1)
Transporters [BR:amj02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   102575554 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 102575554
NCBI-ProteinID: XP_014466003
LinkDB
Position
Un
AA seq 816 aa
MQATGCLGVPTLHKLPSVFMVAALLGLLPLLHSHGLQPNPMLASEAPHHYPAVVRGNEPG
DFTSAPPGISEEIHPLSKHSSNHTGNGHSKPEKAFPVLGIDYTRIRIPFEISLWILLACL
MKLGFHVIPSVSNIVPESCLLIVVGLLVGGLIKGVGESPPILNSEIFFLFLLPPIILDAG
YFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYAVCQIGGTGLNHIGLLANLLFGSII
SAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANIKQVTIIHILLG
FISFFVVSLGGVFIGIIYGIVAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIM
ALIAAGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGKHYWNWTFV
ISTLLFCLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLCYLLDYSHF
NMRDMFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGI
EDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGI
GKIPSAVSTVSMQNIHPKTLPVERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTL
VADPYEEAWNQMLLRRQKVRQLEKKMNNYLTVPAHKVDSPTMSRARIGSDPLAYEPKPDS
ENLPIITIDPASPQSPESVDLVNEEMKGMSRLPPSPEEDEEGLVMRVKEPSSPGTDDVFT
PGTSDSPSNQRMLRCLSDPGPQPEPEEGEPFIPKGQ
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgcaggcgacaggctgcctgggggtcccgaccctccacaagctgcccagcgtgttcatg
gtggcagccctgctggggctcctgcctttgcttcacagccatggcttgcagccgaaccct
atgctggcctcggaggcaccccaccactacccagcagtggtccggggcaacgagccgggg
gacttcacgtctgcccctcctggcatctcagaggagattcaccctctgagcaagcactcc
agcaaccacacaggcaatgggcacagcaagcctgagaaagctttccccgtcctgggcatt
gactacacccgcatccggatcccctttgagatctcgctctggatactcttggcctgcctc
atgaaactgggtttccacgtcattccctccgtgtccaacattgtgccggaaagctgcctg
ctcattgtggtgggcctcctggtcggggggctcatcaaaggcgtgggggagagccccccc
atcctgaactccgaaatcttcttcctctttctcctcccacccatcatcttggatgccggc
tacttcctgcccctgcgccagttcacagagaacctgggcaccatcctcatcttcgctgtg
gtggggacgctgtggaacgccttcttcctcggcgggctgatgtacgcggtgtgccaaatc
ggcggcaccggcctcaatcacatcggcctcctggccaacctgctcttcggcagcatcatc
tcggccgtggaccccgtcgcggtgctcgctgtctttgaggagatccacatcaacgagctc
ctgcacatcctggtgtttggggaatccctgctcaatgatgctgtcaccgttgtgctctac
cacctctttgaggagtttgctaacatcaaacaagtgaccatcatccacatcctcctgggc
ttcatcagcttcttcgtggtgtccctgggcggtgtcttcatcggcatcatctacgggatc
gttgcagccttcacctcccgcttcacctcccatatccgtgtcatcgagcccctcttcgtc
ttcctctacagctacatggcttacctgtcggctgagctcttccacctctccggcatcatg
gcgctcatcgctgctggcgtggtcatgcgcccatatgtggaggccaatatctcccacaag
tcccataccaccatcaagtacttcctgaagatgtggagcagcgtcagcgagacgcttatc
ttcatcttcctcggcgtttccactgtggccggcaagcactactggaactggacctttgtc
atcagcaccctgctcttctgcctcattgccagggtgttaggtgtcttgggcctcacctgg
ttcattaacaagttccgcattgtgaagctgacccccaaggaccagttcatcatcgcctac
gggggcctgagaggggccatcgccttctcgctctgctacctcctggattactcgcacttc
aacatgagggacatgttcctcacggccatcatcaccgtcatcttcttcactgtcttcgtg
cagggcatgaccatccgcccgctggtggacctgctggccgtgaagaagaagcaggagaca
aaacgctccatcaatgaggagatccacacccagtttctggaccacctcctgactgggatt
gaggatatctgtggtcactatggccatcaccactggaaagacaagctgaatcgcttcaac
aagaagtacgtgaagaagtgcctgatcgcgggcgagcgctccaaggagccccagctcatc
gccttctaccataagatggagatgaagcaggccatcgagctggtggagagcgggggcata
ggcaagatcccctcagcagtctctacagtctccatgcaaaacatccatcccaagaccttg
cctgtggagcgtatcctcccggccctgtccaaggacaaggaggaggagatcaggaagatc
ctgcgtaacaacctgcagaaaaccaggcagaggctgcgatcctacaaccggcacacactg
gtggccgacccctacgaggaagcctggaaccagatgttgctgcggaggcagaaagtccgg
cagctggagaagaagatgaacaattacctgacggtcccggctcacaaggtcgactcgccc
actatgtccagggctcgtattggctcagacccactggcctacgagcccaagccggactcg
gagaacctccccatcatcaccatcgaccctgcatcgccccagtccccggagtcagtcgac
ctggtgaacgaggagatgaagggcatgagccgcctgccgccatcacccgaggaggatgag
gaggggcttgtgatgcgggtcaaggagccgtcctccccgggcacggacgacgtcttcacc
ccggggaccagtgacagccccagcaaccagcggatgctgcggtgcctgagcgaccctggg
cctcagccggagccggaggagggggagcccttcatccccaaggggcagtag

DBGET integrated database retrieval system