KEGG   Alligator mississippiensis (American alligator): 102575720Help
Entry
102575720         CDS       T03087                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04210  Apoptosis
amj04625  C-type lectin receptor signaling pathway
amj04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102575720 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102575720 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102575720 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102575720 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102575720 (MAP3K14)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102575720 (MAP3K14)
Protein kinases [BR:amj01001]
 Serine/threonine kinases: STE group
  Other
   102575720 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 102575720
NCBI-ProteinID: XP_006278651
UniProt: A0A151PCW5
LinkDB All DBs
Position
Un
AA seq 938 aa AA seqDB search
MAVMEIACQGAPDPTVRQQKELAAAKGLNETAGEKQSSVCKVEEPSKGAFPTQWKILNDV
ITKGTAKEETEGSSASISIIAQAECENSQEFSPTFSERPFIADSKRYSRSDSLDQIPNNV
AHATEGKMAPACWRARHRGKARKKRHKKKSRLRIQTMVSTKQGPRTPEQESCMPIPVQED
ETPQNTFFSNGSWFSELCKDSVCNQFPFEKSGKVLPTGKLPSLRNQHAPRLHKLISPIQY
LNHVWKPPCQRNHLPQPETLHPFPYNILQPGFPALDSSLHAMKLNALETYLQGDLACVDG
GHHLPGLRSECSFPNCVSQSMKTSTDKLSVEEYLVDALKGSVSLGEPRNLASLAKTWRGG
SLDSKEQFQEANESEGVVLNEKLKPVDYEYREDVHWTKCHGSLGVGSFGEVYKIQDKQTG
FQCAAKKVQVEHFRAEELTTCAGVTSPKVVPLYGAVREGPWVTIFMELMEGGSLGQLIKQ
TGYLPEDRALSYLEQTLEGLKHLHAYNVLHGDVKADNVLLSSDGSRALLCDFGHSAHLHP
DGLGKRLVTGDYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPTCSPLTAEVIKVGLEKEPVKRASAAELKAKADTALEQLGGVTS
PWRGEYREPRCLSLNQENNPQTSLSSTINPVSETASGPDLAVSAPCVSRSLQPPSLELSE
ETARTSWNLCKEFLGVSDPTSVLTKSSSYAERAMTVSEQELQQLEIELFLNSLSQPYSLE
EQEQMLSCLSIDSPLASDASEKNSLKASQSLKDTMSSGIHSWNSQSDGQSFSWNNLLYRS
RHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISGQIPASAFSLVTKEGQPV
HYDMEVPDSGIELQCTLAPDCSFSWTWRVKHGQLENRP
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaattgcttgccaaggagctcctgacccaactgtcaggcaacagaag
gagcttgcagccgctaaagggctaaatgaaacagcaggcgagaagcagagcagtgtttgc
aaagtagaagagccaagcaaaggtgcctttcccacccagtggaagatcctgaatgatgtg
atcaccaagggaacagcaaaagaagagacagaaggaagctctgcatccatttctatcatt
gcccaagcagaatgtgagaacagtcaagagttcagcccaacattctcagagagacctttc
attgctgatagcaaacgttacagccggtcagacagtcttgatcaaattcctaacaatgtg
gctcatgcaactgaggggaaaatggcacctgcctgttggagggcaaggcatcgcggcaaa
gctaggaagaaacggcacaaaaagaagtccaggctcagaatacagacaatggtctctact
aagcaagggcccagaacaccagaacaagaaagctgtatgccgattccagtccaggaagat
gaaaccccccaaaacactttcttcagtaatggctcctggttttcagaactgtgcaaagat
tcggtctgcaatcagttcccatttgagaaatctggaaaggtgctacccacaggcaaactc
ccttcactaaggaaccaacatgcaccacgtttgcacaagttgataagcccaattcagtac
cttaatcatgtttggaagcctccctgtcagaggaatcatctgcctcagccagagacactc
catcccttcccctataatatattacagcctggcttcccggctctggacagttctcttcat
gccatgaaactgaatgctctagagacatacctccagggtgatttggcctgtgtggatggt
gggcatcatttacctggcctacgatcagaatgcagcttcccaaactgtgtcagccagtcc
atgaaaaccagcacggacaaactttctgtggaagaatacctggtggatgccttaaaaggg
agcgtgagtctcggtgagccgcgaaacttagccagcctagccaagacgtggagaggaggc
agtctggattcaaaggagcagtttcaagaggcaaatgaaagtgaaggggtcgtgcttaat
gagaaactaaagccagtggattacgagtaccgagaagatgttcactggaccaagtgccat
ggctctctgggtgttggctctttcggggaagtgtacaaaatacaggacaaacagacggga
tttcagtgtgctgccaaaaaggtgcaagtcgaacactttcgtgcagaggagttaacgaca
tgtgctggggtgacgagtcccaaagttgtccctttgtatggagcagtcagggaaggtcct
tgggttacaatattcatggagctaatggaaggtggctcacttgggcagctaattaaacag
acgggttatttgccggaggaccgagccctcagttacctggagcaaacactagaggggctg
aagcatcttcatgcttacaacgttctgcatggagatgtaaaagcggacaatgtgctctta
tccagtgatggaagcagggctctcctctgtgactttggtcattctgctcaccttcatccg
gatggcttggggaaacgcttggtgacaggggactacgtgcctggtacagagacacacatg
gctccagaagtagtaatgggcaagcgctgtgactcaaaggtggatgtctggagcagctgc
tgtatgatgctacatatgctcaatggctgtcatccttggacccagtattataatcatcct
ctgtgcctgaagatagcaaaggaaccacctcctctgagggaaatcccgcctacctgtagt
cctctcacggctgaggtcattaaagtggggctggagaaggaaccagttaaaagagcttct
gcagctgaattgaaggctaaagctgatactgcacttgagcagttgggaggtgtaacaagc
ccctggaggggggagtacagagaacctagatgcttgtctctgaaccaagaaaacaatcca
caaacttctctgtcctcaacaattaacccagtttctgagactgcttctggcccagacttg
gcagtcagtgctccctgtgtaagtcgaagcctgcagccaccatctctggaactgtcagaa
gagactgcgagaacctcttggaatctgtgtaaggagttccttggggtctctgatcccact
tctgtcctcaccaaaagcagcagctatgcagaacgagcaatgactgtttcagaacaggag
cttcaacagttggaaatagaattatttttgaacagcctgtcacagccgtactctctggag
gagcaagaacaaatgctttcgtgtctcagtattgacagtccccttgcatctgatgccagt
gagaagaactccctgaaggcctctcagagcctgaaggacaccatgagctctggaattcac
tcctggaatagccagtcagatggacagagcttcagttggaataacctgctgtatcgcagt
cgacacacagacactcccagctatttcaatggagtgaaaatccagatccagctgctaagc
ggagaaaacctacatatccgagacttccacaggacaaaggttggagacattgccacaggg
ataagcggccagatcccagcctccgctttcagccttgttacaaaggagggacagcctgtt
cactatgacatggaagtcccagattctggtatcgagctacagtgtaccctcgcccctgac
tgcagcttcagttggacctggagagtcaagcatggtcagctggagaacaggccataa

DBGET integrated database retrieval system