KEGG   Alligator mississippiensis (American alligator): 102575901
Entry
102575901         CDS       T03087                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04068  FoxO signaling pathway
amj04217  Necroptosis
amj04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102575901 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102575901 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102575901 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amj03000]
    102575901 (STAT3)
Transcription factors [BR:amj03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102575901 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 DUF4795 Fib_alpha AP1AR Baculo_PEP_C Syntaxin-6_N
Other DBs
NCBI-GeneID: 102575901
NCBI-ProteinID: XP_006264624
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEATDPGAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacccggtacttggagcagctccaccag
ctctacagtgacagcttccccatggagctgcggcagttcttggccccctggattgagagc
caggactgggcctacgctgccagcaaggagtctcacgccacactggtgttccacaacctg
ctgggtgagatagatcagcagtacagccgcttcctgcaggagtccaacgtcctctaccag
cacaacctgcgcaggatcaagcagtttctgcagagcaggtacctggagaaaccaatggaa
attgcccgcattgtagctcggtgtctgtgggaagaatctcgccttctccaaacggctgca
accgcagctcagcaaggtgggcaggcaactcaccccacagctgctgtagtgacggagaaa
cagcaaatgctggagcagcatctgcaggacgtgaggaagagggtgcaggatcttgagcaa
aagatgaaggtagtggagaacctccaggatgactttgacttcaactacaagaccctgaaa
agtcaaggagacatgcaggatctgaatggaaataatcagtcagtgacacggcagaaaatg
cagcagctggagcagatgctgacagcactcgaccaaatgcgcagggggattgtgagcgaa
ctggctgggctcctgtcggccatggagtatgtgcagaaaacactggcagatgaggagctg
gctgactggaagagaaggcagcagattgcgtgcattgggggccctcccaacatctgcctg
gatcgcctggaaaactggatcacatcccttgctgagtcacagctgcagacccgccagcag
atcaagaaactggaggagctacagcaaaaagtgtcctacaaaggagaccccatagtccag
catcggcccatgctggaagaaaggattgtggagctgttcaggaacctaatgaaaagtgcc
tttgtcgtggagaggcagccctgtatgcccatgcacccagatcgccccctggtcatcaaa
actggtgtgcagttcaccaccaaagtcaggttgctggtcaaatttccggagctgaactat
cagctgaagatcaaggtgtgcattgacaaggactccggtgatgttgcagcactcaggggc
tcccggaagttcaatatcctggggacaaacaccaaggtcatgaacatggaggagtccaac
aatggcagtctttccgcagagttcaagcacttgacactgcgggaacaaaggtgtggcaac
gggggcagagccaactgtgatgcctcactgatagtcactgaggagctgcatctcatcacc
tttgagacagaggtttatcaccaaggcctgaagatcgacttggagacccactcgctgcct
gtcgtggtcatttcgaacatctgccagatgccgaatgcctgggcgtctatcctatggtac
aacatgttgaccaacaaccccaagaatgtgaacttcttcaccaagccgccaattggcacg
tgggaccaggtggctgaggtgctgagctggcagttctcctccaccaccaagcggggcctc
agcatcgagcagctcacaacgctggcagagaaactcctaggcccaggtgttaactactct
gggtgccagatcacatgggccaaattctgcaaggagaacatggctggcaaagggttttcc
ttctgggtctggctggacaacatcattgacctcgtgaagaaatatatcctggctctgtgg
aatgaagggtacatcatgggattcatcagcaaggagcgtgaacgagccatcctgagcacc
aaaccaccaggtaccttcctcctgaggttcagcgagagcagcaaggaaggcggcatcacc
ttcacttgggtggagaaagacatcagtgggaagacccagatccagtcggtggagccgtac
acaaagcagcagctcaacagcatgtcgtttgcggaaattatcatgggctacaagatcatg
gacgcgaccaacatcctggtctcgcccctggtatacttgtaccctgacatccccaaggaa
gatgcctttgggaagtactgccgtcccgagagccaggagcaccctgaagccacagaccca
ggtgctgctccatatctgaagactaagttcatatgtgtcaccccaacgacctgcagtaac
accattgacctgccaatgtccccacgcacgctggactcgctcatgcagtttgggaacaac
agcgagggagcggaggccaacgcaggaggccagtttgagtctctgacctttgacatggag
ctgactccagaatgcgcctcctcacccatgtga

DBGET integrated database retrieval system