KEGG   Alligator mississippiensis (American alligator): 102575911
Entry
102575911         CDS       T03087                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04141  Protein processing in endoplasmic reticulum
amj04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:amj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102575911 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102575911 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amj03000]
    102575911 (ATF6B)
Transcription factors [BR:amj03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102575911 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB YabA DUF4407 GAS
Other DBs
NCBI-GeneID: 102575911
NCBI-ProteinID: XP_019341620
LinkDB
Position
Un
AA seq 534 aa
MEQPPTPPCALGDVLAPPSSTVHISLVPPSDAQATPGRPVPITKPEGGLSRKPPLQPKPL
VVTAVPMPPSAPPGQALLLQPLPHGQPPTIAVRAPPVVLSSSELLHLPVSGLLQVKAPGP
EGPPGKPPKPEAKTIVPAPGQVGSCAQEIDMKVLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLHEALAENERLRRENAVLRRRLDGVLSENTELKFGSGNRKVVCIMVVLLFIAFNFG
PISISEQRPGDLEPPGEAVEPGPSRRHLLEVGQEVPVEPTLAPQPDLPPPGLAQAPFRNL
TGPLSGMKDLMLRDLDKFFLASDCRQFNRTESLRLADELSGWVRRHQINRRKPLQARETP
GRQPSPARPEPSSSRYVPASAPRHPERAALSQLQVYQRPGRGQYDFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLLMPAMALNESVYRAGRDYEVMMQIDCEVMDTRVIHI
KSSTVPPSLRRPQAPAPSDNGTQASSVGTRPPRGAPRSARRPPRPLYLSGYGDG
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggagcagccacccactcccccttgcgctcttggcgatgtcctcgccccccccagcagc
actgtccacatcagccttgtgcccccttcagatgcccaggctaccccagggcggccggtg
cccataaccaagcctgaaggggggctgagccggaagccacccctgcagcccaagcccctg
gtggtgacagctgtgcccatgccccccagtgctccccctggccaggctctgctgctgcag
cctctgccccatggtcagccccccaccattgcagtgcgggcaccgccagtcgtgctctca
tcgtctgagctgctgcacctgccggtctcggggctgctccaagtgaaggctccagggcct
gaggggcccccagggaagccccccaagcccgaggccaagaccattgtcccggccccaggg
caggtggggtcctgtgcccaggagattgacatgaaggtgctgaagcggcaacagcgcatg
atcaagaaccgggagtcagcctgccagtcgcgccgcaagaagaaggaatacctgcagggc
ctggaggcccggctgcatgaggccttggccgagaacgagcgcctgcggcgggagaatgct
gtcctccgccgccgtctcgacggtgtgctcagcgagaacacggagctgaagtttggctca
gggaaccggaaggtcgtctgcattatggttgtgctgctcttcattgctttcaactttggg
cccataagcatcagtgagcagcgcccaggagacctggagccgccgggggaggccgtggag
ccaggacccagccgccggcacctgctggaggtgggccaggaggtcccagtggagcccacg
ctggcaccacagcctgacctgccccctcctggcctagcccaggcccccttcaggaacctg
acaggtcccttgtcggggatgaaggacctgatgctgcgggacctggacaagttctttctg
gcctccgactgccgccagttcaaccgcacggagtcgctcaggctggctgatgagcttagc
ggctgggtccggcgccaccagatcaaccggaggaaacccctgcaggcccgtgagaccccg
ggccgccagccatctcctgcccgcccagagcccagttcatctcgctacgtcccagccagt
gcccccaggcaccccgagagggcggcactgagccagctgcaggtgtaccagcgtcctggg
cgggggcagtatgatttcctggatgccattgacaggcgtgaggacaccttctacgttgtc
tctttccgccgggaccaccttctcctcccagctatcagccacaacaagacctcgcggccc
aagatgtcactgctcatgcctgccatggccctcaatgagagtgtataccgtgcagggcgg
gactacgaggtcatgatgcagattgactgtgaggtcatggacacacgcgtcatccacatc
aagagctccacggtgccaccttccctgcgccgaccccaggcccctgccccctcggacaac
gggactcaggcatcctcggtgggcacccggcccccccgtggggctcctcgctctgcccgc
cggcccccccgccccctctacctcagcggctatggtgatggttag

DBGET integrated database retrieval system