KEGG   Alligator mississippiensis (American alligator): 102576031Help
Entry
102576031         CDS       T03087                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00052  Galactose metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102576031 (LCT)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     102576031 (LCT)
    3.2.1.108  lactase
     102576031 (LCT)
Chaperones and folding catalysts [BR:amj03110]
 Intramolecular chaperones
  Others
   102576031 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 DUF5032 Cellulase
Motif
Other DBs
NCBI-GeneID: 102576031
NCBI-ProteinID: XP_019335745
LinkDB All DBs
Position
Un
AA seq 1656 aa AA seqDB search
MAVLLFSLTFHECNSKTENMPIPVAALFKDIIKEEALTMGYDVNKFLDSSSARAFSSYAG
NALQEGQAAAPLSSYQKVWETFANQTALERDSFLSDVFPSGFLWGVSTGAFNIEGGWAED
GKGESIWDQFGHQGHAYMNQTADVACDSYHKTNYDVYLLRGLQSKLYKFSISWSRIFPSG
IKASLNPRGVDYYNKLINSLQDSNIEPMITLFHWDLPQALQDLGGWQNDSIVDAFAAYAD
FCFATFGDRVKLWITFHEPWVISYAGYGTGKHPPGIVNPGVASYKVAHTILKAHAKAWRL
YDDKYRSQQHGKVGLVLNSDWAEPRSPASLDDVKAAERYMHFMLGWFAHPIFVNGDYPDI
LKSQIQQTNQHCSSPVAHLPSFTEEEKLLVKGTADFFGLSHYTSQLVSAGANDTCSPAYE
NFGNFSQHVDPAWPQTVSSWIRVVPWGLRRLLNFVSQEYTGTKVPIYIAGSGMPTGAGGD
AVNDTERMDYFRLYINEALKAVKLDAVDVQSYIVRSLIDGFEGPVGYSQRFGLHHVEFGD
SNRQRTPKKSAYYFSNIIEKNGFPSKVLHRSFKPVTFDTALPMRLLGLPASEVPSKAKVV
WEKFSPQTKFERDMYFYGNFPGDFVWGVSTSAYQIEGGWDADGKGPSIWDNFTHIPGNIK
NSDTGDIACDSYHKVDEDLYMLRALGVKSYRFSLSWPRIFPTGRNDSINSHGVDYYNRLI
DGLTANNITPMVTLYHWDLPQALQDIGGWENESLIDLFNSFADFCFQTFGDRVKFWMTLN
EPYVSAWIAYGVGEFPPNVKNDPGYAPYKIAHTLLKAHARVYHTYDRKYRASQRGVISLS
LNADWVEPKTLDDPRDTEAADRSLQFMLGWFAHPIFKNGDYPEAMKWTVGNRSELQNLPL
SRLPAFTAQERGYIRGTADVFCINTYTSSIVKHKTPKLKPFSYEDDQELSSEVDSSWPTS
ALANMRPVAWGLRRLLNWIKEEYNNPPIYITENGVGIKATPDVDDTNRIFYYKTYIDEAL
KASRLDGVNLRGYIAWSLMDSFEWVNGYDPRFGLHQVDFKNPSRPRTPKRSALYYAEVIR
NNGIPLPKEDEFVYGEFPKNFSWSVASAAYQIEGAWREDGKGLSIWDQFAHTPLKISNDE
TADIACDSYHKIEEDLASLKGLKVTHYRFSISWSRVLPDGTTKLINEVGLNYYERLIDAL
LAADIKPQVTIYHWDLPQALQNIGGWENETIVQRFKEYAEVLFQRLGDKVKFWITLNEPY
IIANLGYGYGTSAPGISFRPGRAPYIVGHNLLKAHAEVWHLYNTTYRPKQRGLISITINS
DWAEPRNPDKQEDIDAARRYVQFYGGWFAHPIFKNGDYNEVMKRRIRERSLAQGLNESRL
PEFTESEKQRIKGTFDYFGFNHYTTILASNLNYAAGISSYDSDRGVASITDRSWLGSGSF
WLKVTPFGFRKILRWIKEEYNNPPIYVTENGISERGYTGLNDTWRMHYYKSYINEALKAV
VLDGVDLRGYTAWSLMDNFEWATGFAERFGLYYTNYTDPALPRIPKESASYYSSIIQCNG
FPDPATGPHPCLQPQPEGTVTSTATTPTIMGPVPNAAIKKVQFLGLELSLSNAEIALYVL
FALSLAGLLTFALFSYKYRRLSERVHKPPHLELDRL
NT seq 4971 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctactcttcagtttaacgtttcatgaatgtaattccaagacagagaatatg
cctataccagttgctgctctattcaaagacattatcaaagaggaggccttgacaatggga
tacgatgttaataaattcttagactcctcatcagctcgtgcatttagttcctatgcggga
aatgcactacaagaaggccaagctgctgctcccctctcttcctatcagaaagtttgggaa
acctttgccaaccagacagcattggaaagagattcttttctgagcgatgttttcccaagt
ggtttcctctggggcgtgtccacaggtgcctttaacattgaaggaggctgggcagaggat
ggaaaaggagagagcatctgggaccagtttgggcaccaaggtcatgcctacatgaatcaa
acggcagatgtggcctgtgacagttatcacaaaactaactatgatgtttacctgctcaga
ggtcttcagtcaaagctgtacaagttttctatatcctggtcccgaatttttccttctggc
attaaagcaagcttgaaccctcgaggcgtggactactacaacaagctaataaacagcttg
caggactccaacattgagcccatgatcaccttgttccactgggacctcccacaggccctg
caggatctcggtggatggcaaaatgatagcattgtagatgcttttgcagcttatgccgat
ttctgcttcgctacctttggggatcgggttaagttgtggattaccttccatgagccctgg
gtcattagctacgcaggctatggcactggaaagcaccccccaggaatcgttaatccagga
gttgcatcctataaggtggctcatacaattctcaaggctcatgccaaggcctggcgctta
tatgatgacaagtatcgctctcaacagcatggcaaggtgggacttgtcctaaactcggat
tgggctgaacccaggtcccccgccagtttggatgatgtgaaggcagctgaacgctacatg
cacttcatgctgggctggtttgctcaccctatatttgtaaatggtgattacccagatatc
ctgaagtcccagatccagcagacaaatcaacattgctctagcccagttgcccacctccct
tcatttaccgaggaagagaagttgttggtgaaagggactgcagacttctttggcctttcc
cattacacttcccaactggtcagcgctggggctaatgacacttgcagtccagcctatgag
aactttgggaacttttcccaacacgttgatcctgcttggccacagacagtgtcctcctgg
atccgagtggtcccttggggattgaggaggctgctgaactttgtttctcaggagtacaca
gggacaaaggtcccaatttacatagcagggagtggcatgcccacaggagcaggaggggat
gctgttaatgacacggagagaatggattacttccgtctgtacatcaatgaggctctgaaa
gctgtaaagcttgatgcagtggacgttcagtcatacattgtccgatccctgattgatggc
tttgaaggcccagtgggttacagtcaaaggtttgggcttcatcatgtggaatttggagat
agcaacagacaaaggactccaaagaagtcagcttactacttctctaatattattgaaaag
aatggtttccccagcaaagtcttgcacagatcctttaagccagtgacatttgacacggcc
ctaccgatgaggttacttggtttaccagcatctgaagttccctcaaaggcaaaagttgtt
tgggaaaaattctcaccccaaacaaagtttgaaagggatatgtacttttatggaaacttc
ccaggtgattttgtgtggggagtgtcaacttcggcctaccagattgaaggaggctgggat
gcagatggcaaagggcccagcatttgggataatttcacccacatcccagggaacataaaa
aatagtgatactggagatattgcatgcgatagctaccacaaggtagatgaagatctttat
atgctcagagcattaggggtaaagagctatcgcttctcactatcttggcctcgaatattt
cctaccggaagaaacgattccataaatagtcatggggttgactattacaaccggctaatt
gatggtttgactgcaaataatatcacaccaatggtcacactataccactgggatctgcct
caagctctccaggacattggtggctgggagaatgagtcattgatagatttatttaatagc
tttgcagacttctgtttccagacttttggggatagggtgaaattttggatgactctaaac
gagccctacgtctctgcctggatagcatatggtgtaggagagtttccaccaaatgtaaag
aatgatcctggttatgctccctataagattgctcacacattactgaaagctcatgccaga
gtctaccatacgtatgaccgcaaatacagagcaagtcagagaggggttatttcattgagc
cttaatgctgactgggttgagccaaagaccttagatgaccctagagacactgaagctgca
gatcggtccctgcagtttatgttaggatggtttgcccacccaattttcaaaaatggtgac
tatccagaggccatgaaatggactgtgggaaacaggagcgagctacaaaacctgcctttg
tcccgcttgccagctttcacagcacaggagcgagggtacatcaggggcacagcagacgtc
ttctgcatcaacacttacacctccagtattgtaaagcataagacccccaagctgaaaccg
ttctcttacgaggatgaccaagagctatcatcagaagtcgattcatcctggccgacctca
gctcttgctaatatgaggcctgtagcctggggtctccggaggctgctgaactggatcaaa
gaggagtacaacaaccctccaatttatataactgagaatggggtaggaataaaggccacg
cctgatgttgatgacaccaacaggatattttactataaaacctatatcgacgaagctctg
aaagcttccagactggatggtgttaatcttcgaggctacatcgcttggtctcttatggac
agttttgaatgggtgaacgggtacgatccacggtttggattgcatcaggtggattttaaa
aaccccagcaggccgagaacccccaagcgttctgccctatactatgctgaagtcattcgc
aacaatgggatcccgctgccaaaagaggatgagtttgtatatggggagtttccaaagaac
ttttcatggagcgtagcaagtgcagcgtatcagattgaaggggcctggagagaagatggg
aaaggactcagcatttgggaccaatttgctcacactcccctgaaaattagcaatgatgaa
actgcagacattgcctgcgacagctaccacaaaattgaggaggacttggctagtctgaaa
ggcctcaaagtgactcactatcgcttttccatctcctggtcccgtgttctccctgatgga
actactaaacttataaatgaagttggattaaactactatgagaggcttattgatgctctt
cttgctgctgacataaagcctcaggtaactatttaccactgggacctcccccaggccctg
cagaacattggagggtgggagaacgaaactatagtccagaggtttaaagagtatgctgaa
gtccttttccagaggctgggagataaggtgaaattctggataaccctcaatgaaccctac
atcattgcaaaccttggctatggctacggcacatcagctccagggatctctttcaggcca
ggtcgagccccgtacatagtagggcacaacttgttaaaggcccatgctgaagtctggcac
ctgtacaacacaacctaccgtcctaaacaacgaggattaatctccattaccatcaactct
gactgggcagaaccaaggaaccccgacaagcaggaggatattgatgctgccaggcgatat
gtgcagttttatggtggctggttcgctcaccccattttcaaaaatggtgactacaacgaa
gttatgaagaggaggatacgggagcgcagcctggcccaggggctcaacgagtctcgactc
ccagaatttactgagagtgaaaaacagagaattaagggcacatttgactacttcggattc
aatcattacacaaccatcctggcctctaacctgaactatgctgctggtatctcctcctat
gactctgataggggcgtggcttccataacagaccgcagctggctgggctctggctccttc
tggttaaaggtgaccccgtttggcttcagaaagatcctgaggtggataaaggaggaatac
aacaaccctccgatttacgtgactgagaatggcatttctgaacgtggctacacaggcctc
aatgacacttggcgaatgcactactacaagagttacattaatgaagcgctaaaagctgtt
gtactggatggcgttgatctgcgagggtacacagcctggtctctgatggacaactttgaa
tgggcaacaggctttgctgaaaggtttggtttgtattacaccaactacacggaccctgct
ctgcctcgcattccaaaggaatctgccagttattactcatccatcatacaatgcaatgga
ttcccagacccagcaactggaccacatccatgtcttcaaccccagcctgaaggtactgtg
acatcaactgctactacacctaccataatggggcctgtgccaaatgcagccataaaaaaa
gtacaatttttgggattagagttatctttgtcaaatgcggaaatagcgctgtatgtactc
tttgctctctccctggctggtctgttaacatttgctcttttctcctataaatataggaga
ctatccgaaagagtccacaaaccaccacacctagagctagatagattgtaa

DBGET integrated database retrieval system