KEGG   Alligator mississippiensis (American alligator): 102576304Help
Entry
102576304         CDS       T03087                                 

Gene name
PARK7, DJ-1
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amj01002]
    102576304 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amj04147]
    102576304 (PARK7)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     102576304 (PARK7)
Peptidases [BR:amj01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   102576304 (PARK7)
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102576304 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 102576304
NCBI-ProteinID: NP_001274218
UniProt: Q4W7H7
LinkDB All DBs
Position
Un
AA seq 189 aa AA seqDB search
MSAKRALVILAKGAEEMETVIPTDLMRRAGIKVTVAGLTGKEPVQCSRDVFVCPDTSLED
ARKEGPYDVVVLPGGNLGAQNLSESSAVKDILKDQEMRKGLIAAICAGPTALLAHGIGFG
SKVTTHPLAKDKMMNGEHYKYSENRVEKDGNILTSRGPGTSFEFGLAIIETLMGKEVSDQ
VKSPLILKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaaaagagccttagtaattctggctaaaggagcagaggagatggaaactgtt
atccccactgatcttatgagaagggctggaatcaaggtcacagttgcaggcctaacagga
aaagagccagtgcagtgcagccgagatgtctttgtttgtcctgacaccagtttggaagac
gccagaaaagaggggccttatgatgtggtggtcctaccaggaggtaatctaggagctcag
aacttgtcagagtcctctgctgttaaagacatcctgaaggaccaggagatgaggaaaggc
ttgattgctgccatttgtgcaggtccaactgcccttctggcacatggaatagggtttggg
agcaaagttactacacatcctttggctaaagataaaatgatgaatggggaacactacaag
tactctgaaaaccgggttgagaaggatgggaacattcttaccagtcgtggtccaggcacc
agtttcgagtttggcttggctattattgaaacgctaatggggaaggaggtgtctgaccaa
gtgaagtctccccttatactgaaagattaa

DBGET integrated database retrieval system