KEGG   Alligator mississippiensis (American alligator): 102576399Help
Entry
102576399         CDS       T03087                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00010  Glycolysis / Gluconeogenesis
amj00030  Pentose phosphate pathway
amj00051  Fructose and mannose metabolism
amj00052  Galactose metabolism
amj01100  Metabolic pathways
amj01200  Carbon metabolism
amj01230  Biosynthesis of amino acids
amj03018  RNA degradation
Module
amj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102576399 (PFKM)
   00030 Pentose phosphate pathway
    102576399 (PFKM)
   00051 Fructose and mannose metabolism
    102576399 (PFKM)
   00052 Galactose metabolism
    102576399 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102576399 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amj01009]
    102576399 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amj03019]
    102576399 (PFKM)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102576399 (PFKM)
Protein phosphatases and associated proteins [BR:amj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102576399 (PFKM)
Messenger RNA biogenesis [BR:amj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102576399 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102576399
NCBI-ProteinID: XP_006273400
UniProt: A0A151P4Y9
LinkDB All DBs
Position
Un
AA seq 841 aa AA seqDB search
MSINTRLESWPFLVMWAPLNFTLLWSKLFLSASLAFAAVFFFLTFFPFSQKRKELPAKKK
MQPQERNEHTYSLGTGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGLV
DGGNNIKEATWESVSMMLQLGGTVIGSARCQDFRTREGRLKAACNLVKRGVTNLCVIGGD
GSLTGADTFRAEWSGLLADLVKTGGITADEAKKSSFLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLACGADWVFIPESPPEDDW
EEHLCRRLTETRGRGSRLNIIIVAEGAIDKHGKAITSEDIKSLVVKRLGYDTRVTILGHV
QRGGTPSAFDRILGSRMGVEAVMALLEGTPDSPACVVSLSGNQAVRLPLMECVQVTKDVT
TAMKEGRFDDAVKLRGRSFQNNWNVYKLLAHVRPPSTKSGYNLAVLNVGAPAAGMNAAVR
STVRIGIIHGHRMLAVHDGFEGLAEGKVEEIGWAGVGGWTGLGGSKLGTKRTLPKKYFEQ
ISATISDFSIHGLIIIGGFEAFTGSLEMIDGRAKFEELCIPICVIPATVSNNVPGSDFSI
GADTALNTITMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIYEDPF
TIRDLQINVEHLTEKMKTTVKRGLVLRNEKCNDNYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGTPTPFDRNFGTKMGTKAVAWITGKIKECSRHGRIFANTADSACLLGMRRRSLVF
QPLAELKEQTDFDHRLPKEQWWLKLRPILKILAKYKIDLDTSEKAHLEHITRKRVSMESN
I
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgtctataaataccaggctggagagctggccctttctggtcatgtgggctcccctgaac
ttcacactcctttggtccaaactcttcctttctgcgtcgcttgcttttgccgccgttttc
tttttcctcaccttcttccccttttcccagaaaaggaaggagctgccagctaagaaaaag
atgcagccacaagaaagaaacgagcacacgtacagcctggggaccgggaaggccatcgcc
gtgctgacctcaggaggagatgctcagggcatgaatgcagctgtccgggccgtagtccga
gtgggcatctacacaggcgccaaggtctattttgttcatgagggttaccaggggctggtc
gatggaggtaacaacatcaaggaggccacatgggagagcgtgtcaatgatgctgcagctg
ggtggcaccgtgatcgggagtgcccggtgccaggatttccgcacacgcgaaggccgcctc
aaagctgcttgcaacctggtgaagagaggcgtcaccaacctgtgcgtcatcggtggcgac
ggcagcctcactggagctgacaccttccgggccgagtggagtggcttgctggcagacttg
gtgaagacaggtggcatcacggcggacgaggcgaagaagtccagtttcctaaacattgtg
ggcatggtcgggtccatcgacaatgacttctgtggcactgatatgaccatcggcaccgac
tctgccctgcaccgcatcatggagatcgtggatgccatcactaccacagcccagagccac
cagcggacattcgtgctagaggtgatgggccggcactgcggctacctggctctggtgacc
tctctggcctgcggcgctgactgggtgttcatccctgagtctccccctgaggatgactgg
gaggaacacttgtgcaggaggctcactgagaccagaggccgggggtcacggctgaacatc
atcattgtggctgaaggtgccatcgacaagcatgggaaggccatcacttcagaggacatc
aagagtctggtggtgaagcgcctgggctatgacacgagagtcaccatcctcggacacgtg
cagcgtggcgggacaccctccgccttcgaccgcatcctggggagccggatgggggtagaa
gctgtcatggccttgctggaggggactcccgacagcccagcgtgcgttgtcagcctgtcc
ggcaaccaggctgtccgcctgccgctcatggagtgcgtccaggtgaccaaagacgtcacg
actgcgatgaaagagggccggttcgatgatgccgtcaagctgaggggaaggagtttccag
aacaactggaacgtgtacaagctgctggcccatgtgcgcccaccctccaccaagagcggt
tataacttggctgtgctgaatgtcggtgccccagctgctggcatgaatgcggctgtgaga
tcgaccgtcaggattgggatcatccacgggcacaggatgctggcggtgcacgacgggttc
gaggggctcgcggaaggaaaggtggaggagatcggatgggcaggcgtcggcggctggact
gggctgggcggatcaaagcttgggacaaaaaggaccctgcctaagaaatactttgagcag
atcagtgcaaccatcagtgatttcagcatccatgggctgatcatcatcgggggctttgag
gctttcaccgggagcctggagatgattgatggccgggccaagttcgaggagctgtgcatc
cctatctgtgtgattccagccactgtgtccaacaacgtccctggctccgacttcagtatt
ggtgcggacactgccctcaacaccattaccatgacctgtgatcggatcaagcaatctgca
gccggcaccaagcggcgggtcttcatcatcgagaccatgggaggttactgtggctacctg
gccaccatggctggcctggccgctggcgctgatgcagcttatatctatgaagatcccttc
actatccgggacttacagatcaacgtggagcacttgactgagaagatgaagaccacggtc
aagagaggcctggtgttgaggaatgagaagtgcaacgacaactacaccacggatttcatc
ttcaacttgtactcggaggaaggcaagggcatctttgacagcaggaagaatgtgctggga
cacatgcagcagggcgggaccccaacaccctttgacaggaactttggcactaaaatgggc
acgaaggccgtggcctggatcactgggaagatcaaggagtgctcccggcatgggcgcatc
tttgcaaacaccgcggattcagcctgtctcctgggcatgcgtcgacggagccttgtcttc
cagccactcgctgaactcaaagagcagacagactttgaccatcgcctccccaaagagcag
tggtggctcaagcttcgtcccatcttgaagatcctggccaaatacaagattgacttggat
acctcagagaaagctcacttggaacacatcacgcgcaagagagtatccatggagtccaac
atctaa

DBGET integrated database retrieval system