KEGG   Alligator mississippiensis (American alligator): 102577078Help
Entry
102577078         CDS       T03087                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00052  Galactose metabolism
amj00500  Starch and sucrose metabolism
amj01100  Metabolic pathways
amj04142  Lysosome
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102577078 (GAA)
   00500 Starch and sucrose metabolism
    102577078 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102577078 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amj04147]
    102577078 (GAA)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102577078 (GAA)
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102577078 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil GHL15
Motif
Other DBs
NCBI-GeneID: 102577078
NCBI-ProteinID: XP_006270745
LinkDB All DBs
Position
Un
AA seq 968 aa AA seqDB search
MSLKALSPAGAFAPCPRPRPHPGPGQGPGPGPLSAWKRPPASPSPQPPRPCCGMPGTRRG
APGIALQAAVLCLAAVLAAAAPSPADAEGLQSVYRGSRAAAHEHERPGRAAPGQPQCHAG
PERRFDCAPGKLVSRGECEARGCCYVPALAPGSGGWQPWCFFPPGYPSYRLQNLTATDTG
YTASLTRAAASVFPGDVTVLQLDVRFETDARLHFTLRDPANKRYEVPLETPTASSRAVSK
LYGLRFSADPFGLIVLRESSGQVLLNTSVAPLFFADQFLEISTSLPSRFISGLGEHLTPL
VLDTQWTKITLWNRDMAPVPSANLYGSHPFYLVMEDSGAAHGVFLLNSNAMDVVLQPSPA
LTWRTIGGILDFYVFLGPDPKSVVRQYLDVIGYPFMPPYWGLGFHLCRWGYSSSAITRQV
VDNMTAAGFPLDVQWNDLDYMDARRDFTFNRRSFPDYADMVRDFHRDGRHYVMIVDPAIS
STSPAGSYKPYDDGLKRGVFIRNATGQPLIGKVWPGPTAFPDFTNPETQEWWHDVVKAFH
DQVPFDGMWIDMNEPSNFVLGSMEGCPSNKLEDPPYVPGVLGGSLRSATICASSQQHLSS
HYNLHNLYGLTEAIASHNALVRVRGKRPFVISRSTFAGHGRYAGHWTGDVSSSWEQLSSS
VAEVLLFNLYGVPLVGADICGFTGDASEELCVRWTQLGAFYPFMRNHNDHGSQPQEPYAF
SPAAQKAMRKALLLRYTLLPYLYTLFHKAHVAGETVARPLFLEFPTDPNTWTVDHQLMWG
AGLLITPVLEPGKAKVSGYFPAGTWYHLVTDTVIHSKGQWILLPAPLDTINVHVREGHIL
PLQEPGFTTTESRKKGMTLVVALTADGFARGDLFWDDGEGLQTFERGDYTQILFLAMRGT
LVSELLRVNSQVDGLLLQRVAVLGVPSPPQHVLVNGALVDDFSYRTDTEILTIQLSLPLG
EQFTITWA
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgagccttaaggccctgtccccagctggtgcctttgccccctgccctcgccctcgcccg
cacccggggccggggcaggggccggggccggggccgctctcagcctggaaacgacccccc
gcttctccgtccccgcagccgccccgaccctgctgcggcatgcccgggacgcgccggggg
gctcccggcatcgccctgcaggcggccgtcctgtgcctggcggccgtgctcgccgcggcc
gccccgagccccgcggatgccgaggggctgcagagcgtctacagagggagccgcgcggca
gcgcacgagcacgagcgtccgggccgcgctgcccctgggcagccgcagtgccacgccggt
cccgagcgccgcttcgactgcgcgcccgggaagctggtctccaggggggagtgcgaggcg
cggggctgctgctacgtccccgctctggcgccggggtctggcggttggcagccctggtgc
ttcttcccgcccggctaccccagctacaggctgcagaacctgaccgccaccgacacgggc
tacaccgccagcctgacccgggccgcggccagcgtcttcccgggcgacgtcacggtgctg
cagctggatgtgcggtttgagacggacgccaggctgcacttcacgctcagggacccggca
aacaagcgctacgaggtgccgctcgaaaccccgaccgcgagcagccgggcggtctcgaag
ctgtacggcctgcggttctcggccgaccccttcggcctgatcgttctcagggagtccagc
gggcaggtcctgctgaacacttccgtggctcccctgttcttcgcagaccagttcctcgag
atctccacctccctgccctcccgcttcatctccggactgggggagcacctgaccccactc
gtccttgacacccagtggaccaaaattaccctctggaaccgggacatggcacccgtgccc
tctgccaacctctatggctctcaccccttctacctggtgatggaggacagcggcgcggcc
cacggagtcttcctgctgaacagcaacgcaatggatgtggtgctgcagcccagccctgcc
ctgacgtggaggacaattggtggcatcctggacttctatgtcttcctgggcccagacccc
aagagcgtggtccggcagtacctggatgtcattgggtaccccttcatgccgccctactgg
ggcctgggcttccacttgtgccgctggggttactcctcgagtgcgatcacccggcaggtt
gtggacaacatgacagctgcgggcttccccctggacgtgcagtggaacgacctggactac
atggacgcacggcgggacttcaccttcaaccggcgcagcttcccagactacgccgacatg
gtgcgagacttccaccgcgacggccggcactacgtcatgatcgtggacccggcgattagc
agcaccagccctgccggcagctacaagccctacgacgatgggctgaagcgaggggtgttc
atccgaaacgcgacggggcagcctctgatcgggaaggtatggccgggtccgaccgccttc
cctgacttcacaaaccccgagacgcaggagtggtggcacgacgtggtgaaggcgttccac
gaccaggtgcccttcgacggcatgtggatcgacatgaatgagccctcgaacttcgtgctg
ggctccatggaggggtgccccagcaacaagctggaagacccaccttacgtgccaggcgtg
ctgggggggtccctgcgctcggccaccatctgcgcctccagccagcagcacctgtcctcg
cactacaacctgcacaacctgtacgggctgacggaggccatcgcgtcccataacgcactg
gtgcgggtgcgaggcaagcgtccctttgtgatctcccgctccaccttcgctgggcacggc
cgctacgccggccactggaccggggacgtctcgagctcctgggagcagctgtcctcctct
gtagcagaggtgctgctcttcaatctgtatggggtgccgctggtcggagctgacatctgc
ggcttcacgggagacgcctcggaggagctgtgcgtgcgctggacccagctgggcgccttc
taccccttcatgaggaaccacaacgaccacggcagccagccccaggagccgtacgcgttc
agcccggcagcgcagaaggccatgaggaaggcgttgctcctgcgctacacgctgctcccg
tatctctataccctcttccacaaggcccacgtggcaggggagaccgtggcgcgacccctc
ttccttgagttccccacagaccccaacacctggaccgtcgaccaccagctcatgtggggt
gcgggtctcctcattaccccggtgctcgagcccgggaaggccaaagtgagcgggtacttc
cctgcggggacctggtaccacctggtgacggacaccgtcatccacagcaagggccagtgg
atcctcctgcctgctccgctcgacaccatcaacgtccacgttcgggaaggacacatcctg
cccttgcaggagcctggcttcaccacgaccgagtcccgcaagaaggggatgacgctggtg
gtggcactgacagcagacggtttcgcccggggcgacctgttctgggatgacggcgagggg
ctccagaccttcgagaggggcgattacacccagatcctcttcctggccatgcgcggcacg
ctggtcagcgagctgctgcgggtcaacagccaggtggacgggctgctgctgcagagggtg
gcggtgctgggcgtccccagccctccccagcacgtcctggtgaacggcgccctcgtcgac
gacttctcctaccgcacggacaccgagatcctgacaatccagctgtccctcccgctgggg
gagcagttcacgatcacctgggcctga

DBGET integrated database retrieval system